SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D227 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D227
Domain Number 1 Region: 844-903
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000681
Family UBA domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1423-1499
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000149
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D227
Sequence length 1599
Comment (tr|H3D227|H3D227_TETNG) Trinucleotide repeat containing 6C1 {ECO:0000313|Ensembl:ENSTNIP00000014565} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
STSLGDWDQLIIDQRDTEAWPLIKLSPSQASPGGCSLDTDPGPLTSSGSTSNSCSAVNMA
TGANSQTGHFPANHLSNKANSGLNHTNHTGTSMLSNQVAANRSWGSGPGPSHCPSQSSVG
TEVKNDSPVGAGSSRGWGASSSSSAANFNLNLNPNANPSAWPMLGHEGGGTGGGSSGPPP
AQTSTSTGGNTNTISSGIGSAWGNIMASDTLEPHPSPSTNVSFSSEPQNLKTDGPNHTKQ
EPHSPIHHLSSWGNAPAGLGSMSQPSPGGPQVNGEDGSSVWGLSGDSKTPTSKETPAWDS
GWSHGGNGGGNSGGWSEQSGGGWGKQHSEEAQAGWDTPSSPPQELQSSPWSRAVSTTGAS
EGSSDSMESHPRRRDHTSRDNPVPLIPAQDLDPRVLCNTGWGQTPVRQHTSWDMDDAKSK
KDVDTESWGSGSTASNDAHGPSNTNMGPSQRTEGASGWGGSIAATNQSNSSWSESPTNIK
PTGGTGGWSTPPTGGPASSIPKNGAQSWGEKSITTTSQGWGEQPKPSRQEWREPEESKKN
PNNSSWEGEAGGWKEIPRGWGMSSSGTGVSGAGGNAGWGEPTGQRPSATSQGWGGKSQDG
PTISSGGEGMGSWSGPGTVKQGAGWSGIKQDSSSEPTGWEEPSPTSIRRKMEIDDGTSAW
GDPGTYNKAVNLWDRNNSGMSQTKVNTGGNNPQGSNNNNHHPPSHHQSGPSHSRGPLAAQ
GKICHSGWGEIPSSHTKSESSWGDPAPSPVTVDNGTSAWGKPTGGCSSWGDSNPGMAPTS
CKPAPKPMQDGWGGGGDEMNLSGGQWDAEDGDMWNSAASQESNSSCNSWGNASKKIAQKG
KVPGKQEDTWIMNRLIKQLTDMGFPRDPAEEALKSNNMNLDQAMSALLEKKTELDKRGMA
ITGHDYNSGLINKPMNCPRPPLLSKDPSADPRLPFMDKTAAQDIISFSLARYIKSYITIF
IISQVIYFNFLLITRFFSIQQMQSGMFGGGGAEQVRAVQQAQSLQPPVPLFNFSQPSLRV
QVTQFFSLQVQAQLLQFAAKNIGLNPALLTTPINPQHMTLLNQLYQLQLAYQRLQIQQQM
LQAQRNVSGPIRQQEQQVARTISNMQQQIQQHQRQLAQALLMKQQQQQPPPSHSGLHPSG
AKSTLDSFPGHPQAPGFPDMQTKEPQSSPNTYSSYSLAGMNPNMNVNCMEVGGLAMKEPP
QPQSRLSQWTHPHSMESLSGNSSPLEPNLGKHGANLCPPGKPHQLEDSYSPYSLMPSSDS
PSSPLVPPDNWGQGKSSSDKMANGTNINWPPEFCPGVPWKGLQNIDPETDPNVTPGSVPS
GPTINTTIQDVNRYLLRDRSGGKLSEMKSTWSPGPISHSQASLSHDLWKVPQAPRSANTA
PSRPPPGLTNTKPASTWGGTSLGLAQGWSSSYTTAGTTWSTDSSTRTSSWLVLRNLTPQI
DGSTLRTLCMQHGPLITFHLNLTQGSAVVRYSSKDEAAKAQKSLHMCVLGNTTILAEFAG
EEEVNRFFAQGQLLGGTTSWQATPGTNQTRMGGASSGAAHPIGHSSHWTAKTGGELLWGG
VQQYSSLWRPPSAEEGRVMGSPTPINTLLPGDLLSGESM
Download sequence
Identical sequences H3D227
ENSTNIP00000014565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]