SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D2V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D2V6
Domain Number 1 Region: 172-368
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.82e-56
Family Prokaryotic proteases 0.000000727
Further Details:      
 
Domain Number 2 Region: 383-479
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family HtrA-like serine proteases 0.0016
Further Details:      
 
Domain Number 3 Region: 35-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 112-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000503
Family Ovomucoid domain III-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D2V6
Sequence length 482
Comment (tr|H3D2V6|H3D2V6_TETNG) HtrA serine peptidase 1b {ECO:0000313|Ensembl:ENSTNIP00000014844} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RLISESFHSPIMRLGLLLCALAMLVAEARIVKRLAIGCPEKCDKSQCAPIPADCLAGDAL
DRCDCCPVCASGEGEQCGGSGDRDCAEGMECLVADGVEVSATVRKRGAAGLCVCTSSEPV
CGSDGVSYRNICELKRVSNRAVKLQRPPVILIQRGACGEGQQNPDSLRYKYNFIADVVEK
IAPAVVHIELYRKTIFTKREVAVASGSGFVVSEDGLIVTNAHVVANKHRVKVELKSGATF
DAKIRDVDEKADIALIKIDAPMKLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVS
TTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSD
KIRQFLAESHDRQARGQTVQKKKYIGIRMMSLTPTLAKDLKERQSDFPDVTSGVYVIEVI
SRTPAERAGLHEKDVIISINGEPISLASDVSDAIKGGDALRMVVRRGNEDVILTVVPEEI
DP
Download sequence
Identical sequences H3D2V6
ENSTNIP00000014844 99883.ENSTNIP00000014844 ENSTNIP00000014844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]