SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D373 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D373
Domain Number 1 Region: 140-454
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.1e-120
Family Transglutaminase core 0.00000000426
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily E set domains 1.19e-31
Family Transglutaminase N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 461-576
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.5e-27
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 4 Region: 577-676
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-23
Family Transglutaminase, two C-terminal domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D373
Sequence length 677
Comment (tr|H3D373|H3D373_TETNG) Transglutaminase 2, C polypeptide A {ECO:0000313|Ensembl:ENSTNIP00000014961} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VSDMERCDLNIKTNNTDHRTDRYGDKRLVVRRGQPFTLFFLLKPGSTALKPSETSFTVQT
GPLPQKKSNTKVSFGLSGSTPDTEWRASATDGPSEKTVCVSITSAPTAPVGLYALSVKLE
GQKTKLGEFVLLFNAWCLRDAVYMRSETKRQEYVLSQHGQIFRGTSKRIKGTPWSYGQFD
PDILDICLKILDANPKFVSDADQDCSARRDPVYVTRVLSAMINSNDDMGVLVGQWSDFTD
GVHPGSWTGSADILRRWAESGPVCYGQCWVFAAVACTVSRALGIPCRVVTNFGSAHDSNA
NLIIENLYDEDGEDFLGYDSIWWNFHVWVESWMTRPDLGPDFDGWQTSDPTPQETSEGVY
CCGPAPVRAIKEGELTVKYDAPFIFAEVNADVVDLVRLKDGKTVRIGGSTKSVGQFISTK
AVGSDERHDITHQYKYPEGSEEERQVYEKAQHHNKLQKRGEEPGLRLKIKLVDSVVVGWD
FEVFAVLTNNCMEARTCSFLFFARTVSYNGKLGDTCGVISEKVEVPPGGEKRLSLRLEYQ
SYGSKLTSDRLIQLSAVAMDKNSMDFQKAEKNIVLDDPDIQIKLVGEARAKGLLTAELTL
VNSLPEVLKDCSFTLEGVGLTEGGALTHSIGDVGPGQEARASVQLCPSRAGATVLLVNFH
SDKLTNVRSFINVVIGE
Download sequence
Identical sequences H3D373
ENSTNIP00000014961 99883.ENSTNIP00000014961 ENSTNIP00000014961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]