SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D3F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D3F7
Domain Number 1 Region: 439-574
Classification Level Classification E-value
Superfamily TIMP-like 7.85e-28
Family Netrin-like domain (NTR/C345C module) 0.02
Further Details:      
 
Domain Number 2 Region: 215-310
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 392-446
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 4 Region: 329-387
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000213
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.02
Further Details:      
 
Domain Number 5 Region: 130-182
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000457
Family Ovomucoid domain III-like 0.029
Further Details:      
 
Domain Number 6 Region: 41-87
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D3F7
Sequence length 584
Comment (tr|H3D3F7|H3D3F7_TETNG) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 {ECO:0000313|Ensembl:ENSTNIP00000015045} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VWPRFRGGFLRFQWIPARLLMLFICVLPELSVRASAAASDVEHEGFCPNKLNSNLWVDAQ
STCERECNADEDCADFEKCCTNVCGLSSCVAARFPDGAGALLEGQGGINGSDAHASVATC
EGFICSQQGAVCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMDAEACVRGVTLT
VITCRFYLAGPPTSALPQETTANPTPTTSLEDPLPPTLYSNPHHQSIYVGGTVSFHCDVI
GVPRPDVTWEKQSERQERLVMRPDQMYGNVVITNIGQLVVYNAQVWDTGIYTCIARNSVG
VLQADYPLSVIRRDEDDFSEDPELPMGRPFSPADCLAEVDQRACSGERHVDWYYDSSAGS
CTAFSNGGCEDSRNRFATYEECKASCQREGMGVCSLPAVQGPCKAWEARWAWNSVMKECQ
AFVYGGCHGNANSFHTKKECEANCPQPKRKPCKACRVKGKMIPSLCRSDFAIVGWLTELV
EDLDSGLARFSLDEVLKDEKMGLTFFNTKHLEVTIAKIDWSCPCPNITMGENPLLVMGVV
QDGMAIIQSDSYVRATTERRIKRLREVVSKTCKALLLRGFYFLH
Download sequence
Identical sequences H3D3F7
ENSTNIP00000015045 99883.ENSTNIP00000015045 ENSTNIP00000015045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]