SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D3M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D3M8
Domain Number 1 Region: 123-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000458
Family Hairy Orange domain 0.004
Further Details:      
 
Domain Number 2 Region: 42-115
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D3M8
Sequence length 420
Comment (tr|H3D3M8|H3D3M8_TETNG) Basic helix-loop-helix family, member e41 {ECO:0000313|Ensembl:ENSTNIP00000015116} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MDERIAHLQDRPFMEHADFLGMDYPSLYMCKSKRGIKREDGGKDAYKLPHRLIEKKRRDR
INECIGQLKDLLPEHLKLSTLGHLEKAVVLELTLKHLNALTAVTEQQHQKIVALQTGDRS
MKAIHADLDAFHSGFQACAKEVLQYLSQVENWTAREQRCAQLINHLHKVLAQLQTGAPQP
PTQHQLAAADAQDAQKADGQANCVPVIQRTQGGELNENDTDTDSGYGGEAEKSDGKPKET
ERNKAQGHKAVKVKQEFGDEHVSKKPKMSSPGSNLPATDAIRPDLALMNSLMGISSVGQQ
TPICMPFYFINPSAAASYMPFFDKSNIEKYMYPAAAALASPFPWLYPAHAAAAAAAAAFP
GLSAHLGAPSQPSDPRSPDSQEPPDAEAGSPEEPQESPAQGDSDVADAFQESKNSALDPF
Download sequence
Identical sequences H3D3M8
99883.ENSTNIP00000015116 ENSTNIP00000015116 ENSTNIP00000015116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]