SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D4E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D4E5
Domain Number 1 Region: 2-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.52e-83
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 403-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.49e-45
Family Pyk2-associated protein beta ARF-GAP domain 0.00012
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-27
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 4 Region: 660-780
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-25
Family Ankyrin repeat 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D4E5
Sequence length 820
Comment (tr|H3D4E5|H3D4E5_TETNG) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3a {ECO:0000313|Ensembl:ENSTNIP00000015383} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTVDFEECVRDSPRFRANIHEVETEVVEMEAKLDKLVKLCSGMMEAGKAYVGASRLFVGG
IRDLSQHCQKDQVTSEFLEKCGESLQEISNYQTILLDQAQRSVKQQLHNFVREDVRKFKE
TKKHFDKVREDLEMAQVRNAQAPRNKPHEIEEAAGALSITRRCFRHLALDYVLQINVLQT
KKKFEILDAMLSFMQAQHALFQQGYSLLDDIQPYMQNLAAQLDQLVIDSAVEKREMERKH
ATVQQRTLLQDFSGEDWKAEFNLDAPGGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKRLKDALTVVVEDLRLCSVKPFEDIERRFCFEVLSPSKSCMLQAESEKQRQAWIQAVQA
SIASAYRESPDTSEEKRLDRAASPSTSSIDSASEARERGARGDAILQRIQALPGNQQCCD
CGQADPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNAVVN
RIYECSSQDGGSRKPLPSSSRQEKEAWIRAKYVEKRFLKKLGSAHAGQRKPERRRSTKKC
RRHSSSNSLAKTRRRYRQEVGSASPSTLSAEAAKFRRESLFCPDELDSLFSYFDTGSGPR
SLSSDSGLGGSTDGSTDFLLFGSVAEEREVSEGSSGEAELEAEPDTSDTEEGRDLQPGAL
LHRASRNQNLAAMAEALAHGADVNSADHADGGKTPLIQAVVGGSLIACEFLLQNAADVNQ
RDGRGRSPLHHATYLGHTGQVCLFLKRGAAQGDADQDGQDPLSVAVQQANADIVTLLRLA
RMNEEMKESEGQAAPCACSPTEQQLRKCFQEFICLAVAEP
Download sequence
Identical sequences H3D4E5
ENSTNIP00000015383 99883.ENSTNIP00000015383 ENSTNIP00000015383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]