SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3D4J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D4J4
Domain Number 1 Region: 268-443
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.71e-71
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000559
Further Details:      
 
Domain Number 2 Region: 445-545
Classification Level Classification E-value
Superfamily E set domains 2.52e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D4J4
Sequence length 787
Comment (tr|H3D4J4|H3D4J4_TETNG) Nuclear factor of activated T-cells 2 {ECO:0000313|Ensembl:ENSTNIP00000015432} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=NFATC2 OC=Tetraodon.
Sequence
RSYLESRRPAGLALSPRIEITPSREHYSHGRDSLQNQPLNISPRPTLTVPGHENLAYREP
QCLSPASSNSSTSWQSESYSPWTSPCVSPSNGQNPGDLCPRLQSIYTSSPRTSPGTSPGT
ATAEDGCLGARSPSPRPGSRSSSPQGKRTYDMYRNPGLAPGHRSRSPSPHRGHEHPGPQY
THGGLADAANGFASAQAGLVPTKIVKTSNHLYNLYPENQAEGNYALSLEQDVKAKPAEPF
FVIPPIWHKPMVSSICSIPVASLPPLEWPIPGRTDQYELSIEVQPKPHHRAHYETEGSRG
AVKAPTGGHPMVQLHGYRGKEPLGLQIFIGTADERILKPHAFYQVHRITGTVTTTSFEKI
VHGTKVLEIPLEPKNNMKAIIDCVGILKLRNADIELRKGETDVGRKNTRVRLVFRVHVPQ
PGGQHVSLQVASHPIECSQRSAHELPMVEKQDMDHCSVLGGQQMILTGQNFSSDSKVVFM
EKSQEGQHTWEMEASVDKDKSQPNMLFVEVPAYRDASVCHAVKVNFCVINGKRKRSQPQH
FTFTPLAVPSIKTEPLDELEAEHMGFVIPQILGLSSHSYYHSQRGVVYPDSSVASCQRLS
SSLPNHDGRFQPQSPAIVYSRGGKSVGGSPGLYQHPGGMMPDPHCSVLVHTGCPAQPVGA
GQHPSIIQFSPTNQQLVRAGEPQAPQQESPQIIYSEGYSPQATLTPSATPPQAQHVQNYP
TVIQQQPFLQKVQEKARSPPGLGQMEAPGDGQRRVTVKEENLDQAYLDDVNEIIRKDLTG
VQARGQT
Download sequence
Identical sequences H3D4J4
99883.ENSTNIP00000015432 ENSTNIP00000015432 ENSTNIP00000015432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]