SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D5I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D5I2
Domain Number 1 Region: 479-612
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-37
Family Netrin-like domain (NTR/C345C module) 0.03
Further Details:      
 
Domain Number 2 Region: 297-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000172
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 353-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 4 Region: 416-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 101-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000586
Family APC10-like 0.082
Further Details:      
 
Weak hits

Sequence:  H3D5I2
Domain Number - Region: 157-214
Classification Level Classification E-value
Superfamily Sialidases 0.0687
Family Sialidases (neuraminidases) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D5I2
Sequence length 615
Comment (tr|H3D5I2|H3D5I2_TETNG) Netrin 2 {ECO:0000313|Ensembl:ENSTNIP00000015771} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RMREPWRCLLGLCILACLASTHSATNPFAGQQMPQDPCYDDTGAARRCIPEFINAAFGKE
VMVSSVCGRPPSRSCSVVERGDDRPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQ
SENLNTSPHNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQC
RRMYNRPNKATITKQNEQEALCTDGHTDPYPLSGGLIAFSTLDGRPSGKDFDNSPVLQDW
VTVTDIRVVFSRPQLLRELALGPGSNNGGRDDDPTGVTSTLPAYFYAVSDFQVGGRCKCN
GHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHAR
RCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMARPITHRRACKACDCHP
VGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVSPTAVVSSTEE
PADCDSYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETIGDWAKFSVNVVSVYKSRGEPL
KRGDNVLWVHMKDLACKCPKIQMSKRFLVMGGSDSAERVGLMADKNSLVIQWRDVWTRRL
RKFQRKEKKGKCNKV
Download sequence
Identical sequences H3D5I2
99883.ENSTNIP00000015771 ENSTNIP00000015771 ENSTNIP00000015771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]