SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D5V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D5V7
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000219
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D5V7
Sequence length 169
Comment (tr|H3D5V7|H3D5V7_TETNG) UBA-like domain containing 1b {ECO:0000313|Ensembl:ENSTNIP00000015897} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
CASKMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQM
MCAPANTPATPPNFPDALTMFSRLKASESFTSGSVQQPHGRLHGHLSPTPAPAVGRLRAL
RPTCPTCRRPRRLWTQGQPPTQPCPTWPMGVNSHAGAEQKASVAMEAER
Download sequence
Identical sequences H3D5V7
ENSTNIP00000015897 99883.ENSTNIP00000015897 ENSTNIP00000015897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]