SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D621 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D621
Domain Number 1 Region: 122-234
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-40
Family Link domain 0.002
Further Details:      
 
Domain Number 2 Region: 235-318
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-22
Family Link domain 0.0034
Further Details:      
 
Domain Number 3 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000612
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D621
Sequence length 318
Comment (tr|H3D621|H3D621_TETNG) Hyaluronan and proteoglycan link protein 2 {ECO:0000313|Ensembl:ENSTNIP00000015961} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LHRPVSAAAAGTLKYLLEPPVYAEVVAARGEDVALPCILRTKPSQYKVKWSKVEVETVER
EKVIIISSGDAYKTYGHLGRRASLRRAHVLDASLQLSRLELEDGGRYRCQLIHDLHDESV
LVALRIRGVVFPYQSKNGRYKLSYEEARRACVEQDGTLASQEQLYRAWTEGLDWCNAGWL
SDGTVQYPIIQPRPSCGGETSSGLRSYGSRDQEQNFDAFCFTSQTPGSVSFLPGSFSFQQ
AEKACRRGGAQLALVGQLYAAWRFHKYDRCDGGWLKDGSVRFPISNPRRRCGGLPEAGVH
SFGFPDETAHRYGAYCYR
Download sequence
Identical sequences H3D621
ENSTNIP00000015961 99883.ENSTNIP00000015961 ENSTNIP00000015961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]