SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D633 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D633
Domain Number 1 Region: 163-320
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 3.27e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000822
Further Details:      
 
Domain Number 2 Region: 16-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.27e-65
Family DNA-binding protein LAG-1 (CSL) 0.0000101
Further Details:      
 
Domain Number 3 Region: 321-433
Classification Level Classification E-value
Superfamily E set domains 2.33e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D633
Sequence length 489
Comment (tr|H3D633|H3D633_TETNG) Recombination signal binding protein for immunoglobulin kappa J region b {ECO:0000313|Ensembl:ENSTNIP00000015973} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LSLCLCRKFGERPQPQRLTREAMRNYLKERGDQTVMILHAKVAQKFYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDS
DKRKHFMLSVKMFYGNSADIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRL
RSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDEESEGEEFTVRDGYIHYGQTVKLVCS
VTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPC
PKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVHAPVTPVPVVESLQLNGGGDVAMLEL
TGQNFTPNLRVWFGDVEAETMYRCAESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDG
IIYSTTLTFTYTPEPGPRPHCSAAGAILRAGNSSLLSSNSQEAGPGVYGPDSTSSVGVTS
SSSTAAAVV
Download sequence
Identical sequences H3D633
99883.ENSTNIP00000015973 ENSTNIP00000015973 ENSTNIP00000015973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]