SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D677 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D677
Domain Number 1 Region: 103-333
Classification Level Classification E-value
Superfamily L domain-like 1.93e-47
Family Ngr ectodomain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 398-650
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.83e-32
Family Rhodopsin-like 0.0016
Further Details:      
 
Domain Number 3 Region: 25-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D677
Sequence length 657
Comment (tr|H3D677|H3D677_TETNG) Relaxin/insulin-like family peptide receptor 1 {ECO:0000313|Ensembl:ENSTNIP00000016017} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
INSDNSFFVILSASLTGLNISEEATSCPLGYFPCGNLSVCLPQLMHCNGINDCGNQADEE
NCGDNNGWPHLFDKYFAAQHVVMTAEFVWDLDVPSPVLGAVPERCLCRDLELDCDGGQLP
DIPVVAVNVTMMSLQRNLLQELKAKIFFRYHNLQKLYLQHNNIHSVNPDAFRGLYNLTRL
YLSYNRISVLMPGVFQDLHKLEWLILENNDIHQVSPMTFSGLNSLVLLVLLNNSLTKLDD
ICREMPRLNWLDLEGNLIETIGNVSFHSCSMLTVLVLQKNRISHINEQAFSVLHRLGELD
LSSNRLVAIPPNLFLLLEDLLQLNISYNPINKIRVICFLSSKKRLSIEGIEIENIQRRMF
EPLKHLTHIYFKKFQYCGYAPHVRSCKPNTDGISSFENLLANIVLRVFVWVVSATTCFSN
IFVICMRAYIRSENKLHAMCIISLCCADGLMGIYLFMIGAYDLKYRGEYNRHAQAWMDSI
QCQVIGSLAMLSTEVSVLLLTYLTLEKYICIVYPFHLTPGRRRTVSILLGIWVFGFIVAF
LPLACKEPFRNFYGTNGVCFPLHSEQPETLWAYVYSIVIFLGLNLVAFLIIVFSYASMFY
NIQRTGTQTTKYSNHIKNEVTIAKRFFSIVITDSLCWIPIFILKILSLLHVEIPGTV
Download sequence
Identical sequences H3D677
ENSTNIP00000016017 99883.ENSTNIP00000016017 ENSTNIP00000016017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]