SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D6N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D6N7
Domain Number 1 Region: 55-191
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.15e-35
Family Ankyrin repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D6N7
Sequence length 198
Comment (tr|H3D6N7|H3D6N7_TETNG) Regulatory factor X-associated ankyrin-containing protein {ECO:0000313|Ensembl:ENSTNIP00000016177} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
KHPTSLTNKQRGNEVTLLPASIDSLSIHQLAAQGEVSEVAAHLSKVSHVQLYLCVIFADG
SLLNNQDERGFTPLMWAAAFGEKTMVDFLLDKGADPKTIARERESALTLASSGGYVDIVE
SLLRQGADINTYDWNGGTPLLYAVRGNHIKCVQALLASGADMTIESESGYSPMALAFALG
HKKIQKVLENHILKLYKS
Download sequence
Identical sequences H3D6N7
ENSTNIP00000016177 99883.ENSTNIP00000016177 ENSTNIP00000016177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]