SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D752 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D752
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-29
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-22
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D752
Sequence length 502
Comment (tr|H3D752|H3D752_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000016343} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SCYWYIRPGRGIIELDFSYVNIEYHSSCIYDAVYVYDGSSSSSRLLGRLCGSQRATFYST
GAYLTVYFKSDNSVTYQGFRANYQVTVFIFYFFKCSCLSINSGAPCGGYLYGSNDTFYSP
NYPNSYPNYASCYWYIRPGRGIIELDFSYVNIEYHSSCGYDAVYVYDGYSSSSRLLGRLC
GSQRATFYSTGAYLTVYFSSNYIGTYQGFRANYQVVSIKSSNINNSHCNSANMTIVISTF
YLNSLGYDGSNVYLDDPLCRPQFSKYNVTFSFPIDSCGNVKTFEDGRTVYTNSLRAYPTT
YGEITRQDHLKLLVGCRMEQDSVSQIMYRVEHRDNSSITGSGRYATLMHFYTSSSFSYKV
TQVPYEVLLNQELFVQVEMENKDRSLVVFIDTCLASPSPHDFQTRAYYLVRNGCGADSTY
KAYASGFNNYARFSFKAFQFLRATESVYLQCKVLICQASDANSRCRRGCSRRKTRDLQAQ
HDSQTLVTGPIQLKGFKKKDKE
Download sequence
Identical sequences H3D752
ENSTNIP00000016343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]