SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D7E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D7E5
Domain Number 1 Region: 138-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 110-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000213
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D7E5
Sequence length 176
Comment (tr|H3D7E5|H3D7E5_TETNG) EGF-like-domain, multiple 7 {ECO:0000313|Ensembl:ENSTNIP00000016436} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MYQTLLLSSYLFILHVMGTPQFLAPHGRRVCGPDLRYSIVMVTESYVQPVHKPYITLCQG
HRLCSTYKTAYSVRYRQVSKAAPSSPVYPECCPGWRRLHSHHCNQAVCGKPCVNGGTCVR
PNLCACPLGWRGHHCQTDVDECSEQQPCTQECVNTPGSYRCACGKGYRLAGDGRSC
Download sequence
Identical sequences H3D7E5
99883.ENSTNIP00000016436 ENSTNIP00000016436 ENSTNIP00000016436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]