SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D7G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D7G2
Domain Number 1 Region: 108-197
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 803-880
Classification Level Classification E-value
Superfamily DEATH domain 7.85e-17
Family DEATH domain, DD 0.0000937
Further Details:      
 
Domain Number 3 Region: 194-247
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 4 Region: 250-304
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Weak hits

Sequence:  H3D7G2
Domain Number - Region: 2-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000321
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D7G2
Sequence length 893
Comment (tr|H3D7G2|H3D7G2_TETNG) Unc-5 netrin receptor Da {ECO:0000313|Ensembl:ENSTNIP00000016453} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LPRFLEEPVDAYIIKSNPILRCQARPALQIFFKCNGEWVHQSQHMSQEHTDLQTGLKIRE
VMINVSRQQVEDFHGPEDYWCLCVAWSHLGTSKSRKATVRIAYLRKNFEQDPQGTEVPLN
GMIVLHCRPPEGVPVAEVEWLKNEEALISEGLTEKTGDHSLIISEAQLSDSGNYTCVASN
IVAKRRSATATVVVYVNGGWSSWTDWSPCNVRCGRGMQKRSRTCTNPTPLNGGAFCEGMS
VQKSTCSTLCPVDGGWSEWSEWSACTSDCERQRSRECTAPEPKHGGRLCDGVALATDNCT
GGLCTQNRKLLHDAKAQGVESSSDVALYSGLAAGVVTVVLLIVAVTLYRRSQSEYGVDVI
DSSALTGGFQSFSFKTSRQANPLLINSSMQPDLTVSRTYTSPMCFQDSIDKELMAEHSLL
DPLPDLEIKDYYENPSIDSPGIAERAEYHVQSHPQTFPRGLAPDYRAVGTMLGRRGNTLF
APQACLPPSRHVHKATAVFGRAGGRLVVPNTGISLLVPHGGITEDTSWEMYMIINQEDSS
TVSEEESEIFLSPTVTYGPPGLDLSCPIAVTVAHCAEVAADNWTIRLKRQAQDNKWEEVM
SVDEESTSCYCLLEAKRCHLLLEHPGRYALVGAPMNPDAAKRLRLAVFGCPDPSSALGFS
LRVYCVDDTPNAFQEVAVGERGRGGRLLEEPKTMLFRGSAFSLQVSIQDVPQLLWSIKPF
TTCQEFSFSQVWASSRHPLQCAFFLERYSHSSSQLSCKISVRQVKGEEQILQVYTSVLEN
EKTLVPCFSQSDCTVTSQTGSRAFKIPLSIRQRISATFDSASTKGKDWQLLAQKLHIDRN
LSYFACQESPSSVILSLWEAQHQDTGDLDSLASALEEISKDQSSRTAALGGSR
Download sequence
Identical sequences H3D7G2
99883.ENSTNIP00000016453 ENSTNIP00000016453 ENSTNIP00000016453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]