SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D7Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D7Y4
Domain Number 1 Region: 484-629
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-36
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 188-288
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-17
Family PDZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 8-60
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000381
Family SAM (sterile alpha motif) domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D7Y4
Sequence length 974
Comment (tr|H3D7Y4|H3D7Y4_TETNG) Connector enhancer of kinase suppressor of Ras 2a {ECO:0000313|Ensembl:ENSTNIP00000016625} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FEGLDDCLQQYVCVFERGVCGERLLRISHAELEELGVSRIGHQELILEAVDLLCALNSGL
ETESVRTLAHKLGASAKNLQNFISSRRRSSQSESRSSRRLPNDLLTSVVDLITAAKSLLA
CRWTVPPRSPFAAVADYSVTRNNVIQLCLELTTIVQRDDCTVFETENKILHVCKTLSEVC
EHIVCVSSDPLVSQSAHLELVHLTNIKPSEGLGMYIKSTYDGLHVITGTTEGSPADRCKK
IHAGDEVIQVNHQTVVGWQLRNLVGSLRADKGVVSLTLKKRPQSTLSSTPAMLKNMRWKP
LALQPTKSPGSGSATPSGTPTKNSALQDLHIPPPPSEPYTPRDEPGALSGDEASRNHGGA
SVSKRSDSPNSFLDQETRRREEEEPVYCTTPTYGRLRPISMPVECNWAGDYEDPGKMNRE
NRREASLMRYAALSTVDDRTASEEYSSHTARLGKRSNNTAKRAKRRSHHSQSPSHYVLQA
NQRDSPPRDPTPIYHTYQQSSSLQSKTRKKNKGRALASLSRRRVSCKALGRGDCEGWLWR
KRDAKGYFSQKWKKYWFVLKDNCLYWYINEEDEKAEGFVSLPEFKIDRASECRKKYAFKA
CHPKVKSFYFAADGVDDMNRWLSRLNMAAVGYAERERIRQEQDYWSESEHEEDTTASPKQ
DSPPPPYDTYPRPPSMSAYVEGRTTRLSSTETSRSRSSQEDFYRSSPAGGSSETGSPGRS
SSSQRRSWQDLIETPLTEAGLHYLQTGPLEDAVFAEPGPGGGSMMAGAVYTLPAQRNVPL
PVAMQRLIPMATQGGKPRSFTLPRDSNLHSLLVPPAKEEQQPRNGEFATVGVGHPNITQK
LAASELSASEGASLGDLFRACEQGGVCPLGRAPEGRGQSEFRQSFLRRAEDPQLNERLHR
LRILTSTLKDREGELALIDRLLANPQLSSAEFQEWKQAYQELFCQEPEPTSESDTGPPLT
PSLSHTHSYIETHV
Download sequence
Identical sequences H3D7Y4
ENSTNIP00000016625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]