SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D8C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3D8C6
Domain Number - Region: 9-54
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0759
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D8C6
Sequence length 428
Comment (tr|H3D8C6|H3D8C6_TETNG) Family with sequence similarity 69 member A {ECO:0000313|Ensembl:ENSTNIP00000016767} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=FAM69A OC=Tetraodon.
Sequence
MARGPFSRGFFRKLLYVQARFSYLHMKYLFLSWLAVFVGSWVVYVEYSSYTELCRGRECK
NSICDKYRRGLIDGSACSSLCEKGTLSLGTCFSARAKSQVYTGSWGDLEGVIKCRMEEAQ
RYDLENQVEPRKKAAGFDQPSRGTSVEKFREMILDHLKSKVGDQANLADLAAQVLSMTDA
NKDGHISLPEAHSTWALLQLNEFLLALVLQDREHTPKLLGFCGDLYVTEKVPYSPLYGVG
LPWILEVWIPASLRHSMDQWFTPSWPFKAKISIGLLELVEDVFHGTFGSFLMCDVSAGSF
GYNDRHDLKVTDARYIVPEAVFQEDIRQQRCDDDRDCRFGADCLTSCDLTKHRCTTEVTR
PNLAKACETMKNYVLRGAPPDVREELEKQLYACMALKGSAEQMEMEHSLILNNLKTLLWK
RISHTKDS
Download sequence
Identical sequences H3D8C6
99883.ENSTNIP00000016767 ENSTNIP00000016767 ENSTNIP00000016767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]