SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D8K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D8K0
Domain Number 1 Region: 390-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 2 Region: 198-307
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000105
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 3 Region: 29-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000116
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 4 Region: 144-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  H3D8K0
Domain Number - Region: 362-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000903
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D8K0
Sequence length 693
Comment (tr|H3D8K0|H3D8K0_TETNG) Low density lipoprotein receptor-related protein 10 {ECO:0000313|Ensembl:ENSTNIP00000016841} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LLSALFIFTAALFPGLLTSPKRIFPSVICGRSPQVLESRDGEIRSSSYYSWSYRYGSCYD
CWIIKGSEGEPVVLSFSQFSARCRKEWVSIRSSDGGEPVLLCGSKLPKPMEFPGGNITVT
HHFLPHLFPVSSFLLSYARDTGECPLTSFECLGGRCLPLSWRCNGRVECLDEGTALGTDE
QGCGAEEEPTESTANTSTWPCGGLLQTFYGTFSPPALRGPALFCVWTLDPQDSRPLRLDL
QQLVLGPGDKLTVYSRGNGKGDVLKTITSSSNYKSVQVESTTGLLSLAYETLPGSEGNGF
NATFHVGAYCPPWGYTQEQMCDGKYDCPETGRDEKGCKGCGVDQFVCGPTGQRMSTGAHY
GGRPVCYPAKERCNYQLYCSDGSDERDCTVCQPGTFHCDSDRCVFESWRCDGQVDCKDGT
DELNCTVILPRKVITAATVGSLVCGLLLVIAMGCTCKLYSLRTREYSSLFAPISRQEAEL
IQQQAPPSYGQLIAQGIIPPVEDFPTENPNETSSLSLRGILQLLRQDPTNSPHRRRRPRF
VRRAVRRMRRWGLMPRASSRPSQPPNGGQQPSEAGPSAQQGSRAAPTASSSAVQQQGGGR
SSPLPPPQPPPVTSTPPPPYAPPAPPAATPPVVVPSSGSTLASIFHTLGLNIFLFRASPS
SSSTNSMALSDDDVLLIPLTEDAASEDDVPMLT
Download sequence
Identical sequences H3D8K0
ENSTNIP00000016841 ENSTNIP00000016841 99883.ENSTNIP00000016841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]