SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3D8R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D8R3
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily E set domains 0.00000134
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D8R3
Sequence length 436
Comment (tr|H3D8R3|H3D8R3_TETNG) Neurexophilin and PC-esterase domain family, member 3 {ECO:0000313|Ensembl:ENSTNIP00000016904} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VEEQLEVLVQMHDFHGRPKRYGGDFLLARLHSPELGAGVAGRVLDHRNGFYSALFPLLWV
GPAQVEVTLVHPSEAVAVLQRLREERSDRVFFQSLFRLGSLSETTLCNMCLPPDEHPLCN
YTDPHTGEPWYCYKPRMLSCDTRVNHAKGGYLKHLVSSKEALLFQRCVSSTPPPRCVSLS
HTSFRSPSQSFLSVKPDAVPLGTSGFYYRGSWRPLDGTSMHQFNGSSAVVRCLRNKVVDM
FGDSTVRQWFEHLIASVAELKEFNLHSPKNVGPFMAVDSAHNILVRYRCHGPPIRFSTVS
ASELRYISNELDALSGGPDTVVVLSVWAHFSTFPVEVYIRACHIRRALVRLLNRAPDTAV
VIRSANLQALDQDNSLYNSDWFSLQLDQALRSMFGRLDVLLLDAWQMSLAHHLPHALHPH
PPIIKNMVDMLLSYVC
Download sequence
Identical sequences H3D8R3
ENSTNIP00000016904 ENSTNIP00000016904 99883.ENSTNIP00000016904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]