SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D8T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D8T9
Domain Number 1 Region: 382-955,1007-1175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.93e-200
Family Motor proteins 0.0000000311
Further Details:      
 
Domain Number 2 Region: 61-299
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-46
Family Ankyrin repeat 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D8T9
Sequence length 1849
Comment (tr|H3D8T9|H3D8T9_TETNG) Myosin XVI {ECO:0000313|Ensembl:ENSTNIP00000016930} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MEIDQCLLESLPIGQRQRLVRMRCDQIKAYYEREKSLQRHTGAADHRRKPRVQFGLADVI
QDAIVRHDDKEVLRLLKEGADPNTLIPSGGSLLHLCARHDNVFAAEVLIERGVNVNLQDE
DLWTALHVACVCDHADVVLLLLLAGVNMLLQDVNGNIPVDYASEGTESSWILRKHLEENG
VDVSSIHTMKMQRRSTMMSDVRQLVATGEGLSQSNEDGVTLLHIACAGGYREVVSMLLEK
GADPDAADDNFWTPLHLGSKYGQTSVISQLLRHGANPTLLNCNHHKPSDIGASEHITEML
LNAEESWLQRQADPSAPLPSADQCYDGGSHDVNTPVKNMNLGLPLSKRDSLLEKCTLFRE
AGVALIRHPSQDNGLDGPFSSGTSKVEQVKLMPPAPNDDLASLSELTDSSLLYEMQKRFS
NDQIYTYIGHILLLVNPNKELPIYSTLVSQLYLSSTGRLCSSLPPHIFSSAERAYHMMLQ
ERRPQCFVLSGESGSGKTEAFKHIVRHLTGRSSPKGFALEPKMKHVNCILEAFGHAKTPR
NNNSSRFIKLMTIQYCEKRKMPLGARLCTYMLEKSRLVHFHPHQHNFNIFYLMAEGLSPE
ENSTFYLSNVLAHRYIGGGIPGEPPQVAKASAQSKEQLTEVKQALRALGFNKQEVESVFM
LLAAVLHLGDVHFTPLTDADTAFPSDPQLLERVSGMLQVCPNDLSSALTSDVQIFKGDAI
TRRHTVEMSEQNRDQLAKAIYGRLFSYLVNTANGYLQGQDDLLGDPAFEIGILDIFGFEE
FLKNGFEQLCVNIVNERLRRYVSEMLFQQEQAECVLEGVPMEPPCSPCNQPAVLDFFLQQ
RPQGLLSLLDEESQSPRPVEQMLYKRLSAQLESSSGHGLSLTTKDGNGNPPPKDQGPAFT
VHHYAKQISYDLTGSLSRNKDALPQNLVFTMKSSESVLLRQLFRSKLTQTGSLVPTAQGR
AGSRGPKAALLLYKMPSASLVTAGAIPSKPQRSLDLTRILKKKCPSSFLQQLERCGPITV
TIQLKNSLSEVISKLQACTPHFVECVRPNTSGQPDSFDSFHVSAQLQYIRVLEMVRTIRY
GYPVRLSFPCFLSRYKDLTIPMLGDKKKVSPEERCRLVLQQTKLQGWQMGSSKVFLRYWQ
ADQLNDRCYQLHKKIITCQKVVRGWLARRRLHHRQSSRQKMVHSVQRFLQGAEDMGLRTY
DQLVIQNAADIARESDRLRCHGSSLLSTLGKSPPLGERPEPVGNIRHFRSSSVPTPLAME
NLVLSSQSTISHSNEEVLAVGSLSSPRKQPPPKPKRDPNTRLSASYETVSAGLTMAAKES
PTPALSKPRPYSDDYTTMREVPPPKTKQRPNTKLSGSYEEINAVAPHIHQLRPADVKLAL
LSRSAGFGGFGGLMQKAASIDAPQGVGLSLYKGQDEEDVYIEMMGSQQRARSLQEPPDSP
IQADSEAVYEEMKYFPTEDGLGLGLVGLGTSPPQIGESKRATAGMSAASDSTPSQSTLNS
FKTLHGKDGSCDIPAPFPNLLPHRPPLLVCPPSPVTCSPASDESPLTPLEVKKLPVFETN
LNYATAPDSPLSPQCSRQRADSSPSLTVFIPEKKSTPPLTPPPPPPPAQPPPYRAPSHFP
FPPEASFLTLTRAASVAGSSDTPKALSSQRASGEPLGKPPPYSPVKMTRPEPRRAHSCSS
SPLLFNPANGRALTSPLEELNTLFSSGRSLLRKSTSGRKMRDGERFNSNINLPGKDECGS
APTSPSLQLQDKNANNRSTQSSSPVPIENGNQITNGLMEDESHSKPNTSTSTSLHRHMDS
HHIQVINRFRLLSGDEAAASGDLQRWRREQCEGRGDWKGCPPPHTPLPP
Download sequence
Identical sequences H3D8T9
99883.ENSTNIP00000016930 ENSTNIP00000016930 ENSTNIP00000016930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]