SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D915 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D915
Domain Number 1 Region: 680-702,812-966
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-25
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 261-324,453-528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000582
Family Extended AAA-ATPase domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D915
Sequence length 999
Comment (tr|H3D915|H3D915_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000017006} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PSVDEAADALMTRLGFLLGDKIIPGQPESSYPAQDDGENSKVFNSSFQRISPSSSLASSS
TSPCSTLPPPAGGEVNSIVRHAPSNHVSVTSPTSTLESRDSGIIATLTSYSAESAAERDD
VAKYRSDGYHGSRGQRGGQLVASSTSSSCMAAAGRDNDGFLYSVEDNMAASTYSLNKLHP
DRASSSSHSAGSTYSIPLYLMPRPNSVAATSSARLEDLAYLDEQQRHIPSRTSLRMPRQN
SGSRGQQEHRVSFTPSLNLKPLHFEIPGLSSDWLFSGREWLFQEVDAHLRSGDPASNHGV
VIVGNMGFGKTAIIAHLAALSCHGNRMWPTAAGNQTMPKRNFDPHEQIDETDMEAVSLSH
NSLGRGREDEGGGSCPGTPELRRRQEEVVRRLAAQVVSYHFCQADNCHTCLVPEFVLNMA
AMLSDAPQLLAYRERLHRSRELQSTLSMRACIQDPSSALEKGILEPLDALYRERKLHLDR
AGLIVLVDGLNEAEFHRPDYGDTLTSFLSKNIQKFPSWLKVIATVRTSQQDITGPLPFHC
ISLDRIDENSAIDQDLQGYLMQRIHSSAEIQSNVSLSNGRLDNTALAKLISHLKTLSKGS
YLYLKLTLDLIEGGYLVLKSSSFKVVPVSLAEVYLLQLNMRFPTQSSFQRVLPLLNITVA
SLHPLTDQKLYEIVNAGTLGRGALPWAEFTHRLEVSPFLLRRNDGSRMLKHASFREWLMW
REEGQDDRFLCDPRSGHTLMAFWLCRQEGKLNRQQVLDLGHHILKAHIYKGLSKKLGVSS
SVLQGLWLAYSTQSLSPALSSLRNLYTPNIKVSRLLIMGGADVDHRTDVLSNAPLLCAHA
HLGHADVVALLLDQGAQVGAQSHDGVSALGFAAAAGHLDIVTMLSQNAAKVGHVDNSGRC
VLVHAAQRGHIEVLCYLLRNADWSCTPCCSQKAASKDQAVQQALTAAASMGHAQVVSYLL
DLSGKDDKNGQSPEINTPDSLWGETGTVHANVSSQEGEA
Download sequence
Identical sequences H3D915
ENSTNIP00000017006 99883.ENSTNIP00000017006 ENSTNIP00000002165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]