SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D945 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D945
Domain Number 1 Region: 134-285
Classification Level Classification E-value
Superfamily HAD-like 2.24e-30
Family NLI interacting factor-like phosphatase 0.0027
Further Details:      
 
Domain Number 2 Region: 553-659
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000204
Family DNA ligase 0.078
Further Details:      
 
Weak hits

Sequence:  H3D945
Domain Number - Region: 4-72
Classification Level Classification E-value
Superfamily Single hybrid motif 0.000769
Family Biotinyl/lipoyl-carrier proteins and domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D945
Sequence length 908
Comment (tr|H3D945|H3D945_TETNG) CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 {ECO:0000313|Ensembl:ENSTNIP00000017036} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PLRLLEWKIKVGSVVNVDSVLALCTPIPEKRGTEIVKAPERKVRSDRAGVITELCCQLGQ
VIPPGGVIVRIEQCSHPIVMKGLCAECGQDLTQLQSTNGSQQSPISTATVSMVHSVPELM
VSAEQAEQLGREDQQRLHRNKKLVLMVDLDQTLIHTTEQHCHRMSNKGIFHFQLGRGEPM
LHTRLRPHCKEFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDP
FSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFQGTGDINAPPGSREAQT
ERKGDGKRCLPAGRLGALSSGSTDGTEAVGTIGGDEQNNGPRKKGKEQNISGAVESTTCQ
SSQGTGQGLGKSQVDNTDVKDSGGSRTLANSELQDSAYSSALSQESNNLDFDLSSDSDND
TSTDKPSAEHHGEGKSCHVNKSEEEVAEQEDSKGVTEGGKVSKEPSDVLLPDPGNANLDK
RELETESQNSEQSGITTGEELLDQSIEDEDDEDEADNDEDDHLVYLEEVLERVHAEYYVR
YEAYQRKEASESPDIRKIVPELKSKTLEGATIVFSGLYPTNYPIEKTREYYHAKALGAKI
SRNLVLSSKDPGRTTHLIAARAAHPGTEKVRQAQGCKQLQVVNPDWLWSCLERWERVEEQ
LYPLKDDYSKKSRSNSPAAFHENLGSLQKRVFQSAAIRLKPAAPAPEIRTYDPVTGKLIR
RAPQASAPPAFHAPGPLSLSDQIEPSCLRIIQKILKGTSNCRPAETAGSSQDDEQPGPSR
RKRQLSMSETMPLYTLCKEDLESMDKEVDDILGEESDNESEGRGPVEVKCRTSGPQALGL
DERTPEPSSENNILGRVPRGHKRKFDESDEEEEEGRAEKEDSNEEEGGSSSEADEMAAAL
EAELNDFM
Download sequence
Identical sequences H3D945
99883.ENSTNIP00000017036 ENSTNIP00000017036 ENSTNIP00000017036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]