SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D9M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D9M5
Domain Number 1 Region: 2046-2221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-34
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 2 Region: 1290-1425
Classification Level Classification E-value
Superfamily Cadherin-like 3e-32
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 446-571
Classification Level Classification E-value
Superfamily Cadherin-like 3.25e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 745-875
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-24
Family Cadherin 0.00055
Further Details:      
 
Domain Number 5 Region: 1067-1186
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-21
Family Cadherin 0.00018
Further Details:      
 
Domain Number 6 Region: 9-141
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-20
Family Cadherin 0.003
Further Details:      
 
Domain Number 7 Region: 955-1075
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-18
Family Cadherin 0.0027
Further Details:      
 
Domain Number 8 Region: 1188-1302
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 9 Region: 878-967
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-16
Family Cadherin 0.0042
Further Details:      
 
Domain Number 10 Region: 251-326
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000107
Family Cadherin 0.0057
Further Details:      
 
Domain Number 11 Region: 324-390
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000685
Family Cadherin 0.0024
Further Details:      
 
Domain Number 12 Region: 1401-1515
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000214
Family Cadherin 0.0028
Further Details:      
 
Domain Number 13 Region: 1791-1875
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000844
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 14 Region: 2281-2319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family EGF-type module 0.02
Further Details:      
 
Domain Number 15 Region: 1537-1611
Classification Level Classification E-value
Superfamily Cadherin-like 0.000002
Family Cadherin 0.0083
Further Details:      
 
Weak hits

Sequence:  H3D9M5
Domain Number - Region: 672-741
Classification Level Classification E-value
Superfamily Cadherin-like 0.000214
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 2240-2275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0064
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D9M5
Sequence length 2533
Comment (tr|H3D9M5|H3D9M5_TETNG) Si:ch211-186j3.6 {ECO:0000313|Ensembl:ENSTNIP00000017216} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EWYLVRLEITVLDVNDNVPEWIMAPSPYLAVVSPDAPAGSLVYKLHAKDGDEGNNGEVEY
FLSDGGDGRFEVDRKNGQVRTTGLPLQQDREYLLTVVAADQLGSRSIPAVLSVVAGSRPP
QFSNASFTISVPENTPAGQPFIVHALSKTHQMPSISMITAGKMLILQCQSYFQKIYTHIL
KLNGKAVLYILLLCSVEYNTNLCHIKTEISVKIHEENQLSPSYRKACLQWSNRAIYTLPF
FPFFVWLISSSVSASDCDSGENADLTYYTLSPDFTISPHGTIFPAGPLDYERVNHLYEFV
VMAVDKGDVPRTGTTTVRIRMANVNDEAPDFSQHIYRTFVSEDAGPNTLVATVLAKDPDG
DGISYKITSGNEEGNFVIDSQKAVIRKRRKINPIPAPTLKPSLNLKTCFLRKNEQGYPLP
SVSFITQICSVISINTSLGPVHSDCCQQYRESTSVLENQPAGTFVLQVHAVDADEGSNGK
VTYGFMHKDSTVPAFSIHPDTGTIVTARKFDREHQREYAVTVTATDQAADPLIGICQLTI
HILDQNDNNPKFENIRYESPINFNASYNTRLSLHQYINVVRCAVIYTLLALKITKPLTLV
TSSPHIKFQNIKLENASKYDLVPYYCITSKEITLALISTCVDISWVFSPNRSCISLFLYK
TIKATSPLGDPRVTYNLEDGMVPETNMPVRFYLTPNREDGSASILVAEPLDYETTRNFML
RVRAQNVAAVPLAAFTIVXVTTKRDVNDNVPFFTSSIYEASVTEGAETGTLVFQVSANDL
DLGLNGKISYSLLEDRSGDHQFFRIDPELGFIYTQTVFDRETKSSYLLEVQSVDGQESAR
PGKHGQPNSAQTTYLKVFLADFQGNTNRRRRLVYPMAAVKEAPFITMATNDRNAGGNAKL
RYQITSGNTGGVFDVEPEVGTIFVAQPLDYEQNKRYKLHVLASDGKWEDYGTVAVNIVNK
NDEAPVFTVNEYYGSVTEELDGSPVFVLQCYRRLDPGGPPPEYLLFPWAQRVPESEFIID
EVTGKIYAQRTLDREERAVWRFVVLATDEGGEGLTGFTDVIINVWDINDNEPVFTCAPSC
HGSVAENSLVGTSVMEMTATDLDDSAVGQNAVLSYRIMGSLDGANFHDRGVPSSSEMFTI
NPSTGTISVAMEGLDREQVESYLIFVEARDGGGLAGIATATIQIKDLNDHAPKFTDDTCA
VQISENTETNAEVLELAAEDRDIGENAQLTFSVVAGDQEQKFYIVSHKQEQRGTLRLKKK
LDYERHGEQRFNLTLKVEDLDFSSFLHCMVEVEDYNDHAPVFTPHFLSLAPLPEDVSVGT
SVARLVASDSDSGQNREITYSLSEDSDPDGLFTIDQSGVLFVARPLDREHVPQHQLVVIA
TDHGIPELTGSATVQLPLLDVNDNGPEFEAAYAPIVYENVAGPQIVKLNQTSTLLQVMDR
DAPENGPPFHFNVPPEYRYSNDFYLQDNLNGTATLTALRTFDRERQKEFFIPVIMSDSGH
PAKTVTSTLTVTIGDQNDHGHVAGEKTIFINIHRVGRLPTTVIGKVFSPDPDEWDNKTYV
FEGNVPNYFVLNKRTGFLIIKENTPPGTYQFQVRVADDVWPDAVSSVSVHVRELRDEAIY
NSGSLRLADITAREFIELRRGQRSRYDLLGDFLSEMLSVPPNDVNIFSLTDVKDRMLDVR
FAVRVGSSFLQPEKMHGYLAAHKQKLQSFLQIVVFQIRVDECPSSGCAGASGCTNVLNVR
DTPMVVDCGTMSLVSVTLESTAVCSCPGRDQSHQPCSAYPRNPCFNGGVCVDTQHGYRCQ
CPAQFEGPECQQNHSFHGNGYAWFPPLMPCFESHVSLEFITDVADGLLLYSGPLAQLQTW
DHEDFMAIVLSINTPALHKSHSSQKIEFRGTPDFDIVQRKMSNVKSLLTGSRGIILAIQS
PCSGPVVIHSWLCVCVRICVFSLSYLFGTDVVQNCAKWEQNLYKFKHNSTQLHLIASVLR
KRDDESFVGLRQTATVRNQLYDLGNPAESQSSSPGCLTTDSSCVNMGFPSCGRRGRCHGE
WGSFSCQCVTGYTGQQCDEEVPEYSFDGHSHVHYQLQSLLPARRTSFQALVRTRKHSSTI
LNLMSKEQTEYIRVEILQGLLCVSYNIGDGDYNLTLPKYRLDNGEWHEVFLDRHDNEMML
KLDGGGGQREVTGSRGRSREIIIDPTVVMLGNTFPSGINKSFQGCMRDVRLNGRYLPLDS
QPRDGVSQVSVQGLAVGCSSDSCKRNQCSPPFICVDLWRVHECRCPPGHMIRVNGTKKSC
VYTLCATQPCHRGTCVAQSPSKFTCHCPEGYRGRHCETTLAIYREDVGLSFSSLFAICIC
FMALLVLLLGIFLYTRWRSYKGMKEGVYHVSAHHDGWEDIRENVLNYDEEGGGEEDQNAY
DMAELQKSLQPSPAQSLRRDVPPSRLPAQGQARPPQLSRRSISFSSQDLARYLCEIIRDA
DQHPDTGPFDSLQVFSTEGGGSSAGSLSSFSSAGLDGGSGGDAGENAREETLGDWGPRFE
KLRALYEQAETSN
Download sequence
Identical sequences H3D9M5
ENSTNIP00000017216 99883.ENSTNIP00000017216 ENSTNIP00000017216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]