SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DA22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DA22
Domain Number 1 Region: 166-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 3 Region: 332-444
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-28
Family Frizzled cysteine-rich domain 0.00026
Further Details:      
 
Domain Number 4 Region: 283-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 123-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DA22
Sequence length 446
Comment (tr|H3DA22|H3DA22_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000017363} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SPDRPLGCGAVLTDLEGSFSSPNHPGSYPPNLLCMWVIQVPAPFVVQIHVLNLAVEGPSP
CLFDWLEVQEQMALSSVVIRFCGNVAPPTVNTNSSKVWVTFRSDGTIAGSGFAAQYRALL
PGHKSCSRDEFLCDSGRCLLPASVCDGHPNCQDQTDESNCSHKHKDCGGQKSGPSGHLSS
PNHPGNYPHQQLCIWHLSVEEGHVITLSFRNFSLETQDVCEFDYVEVHDSLNTGAGRVLG
RFCGTTLPPDLTSSGPHMSVVFVADEGVADSGFNATYQAVSLLDRTCASNQFACSTGECL
QPQWLCDGWNDCPDAADEHGCDNSTYPPFISSCETIEVEMCRGLSYNLTSFPNIWLSIAD
QREAAALLQQYRVLMDLACFQPLRRLVCGMFLPQCSPQGGVLQPCRSVCSSAEQQCSQAL
DLFSFSWPFNCHLLPDLHDPTECSLP
Download sequence
Identical sequences H3DA22
99883.ENSTNIP00000017363 ENSTNIP00000017363 ENSTNIP00000017363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]