SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DAL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DAL4
Domain Number 1 Region: 279-434
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000552
Further Details:      
 
Domain Number 2 Region: 435-600
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000208
Further Details:      
 
Domain Number 3 Region: 153-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-33
Family Spermadhesin, CUB domain 0.0000239
Further Details:      
 
Domain Number 4 Region: 41-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 686-799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-19
Family MAM domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DAL4
Sequence length 920
Comment (tr|H3DAL4|H3DAL4_TETNG) Neuropilin {ECO:0000256|PIRNR:PIRNR036960} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=NRP2 OC=Tetraodon.
Sequence
FSNFPLTGATCLYLTFPSHVSASSLSFAASECGGVLDASKAGYITSPGYPLEYPSHQNCH
WIITAPEPSQRIVLNFNPHFEIERLDCKYDFIEIRDGTSDTADVLGRHCSNIAPAPIISS
GSSLQIRFVSDYAHQGAGFSLRYEIFKTGSEFCFRNFTSSSGMIESPGFPDKYPHNLECS
YMIIAPPHMDITLTFLTFDLENDPLLVGEGDCKYDWLDVWDGLPQVGPLIGRYCGTKIPP
EIQSPSGLLSLSFHTDMAVAKDGFSARYNLTRKEVSDSFHCSTTLGMESGKISDDQITAS
TTFYDNRWLPRQARLNNNDNAWTPSEDSNKEYIQVDLQFLKVLTGIATQGAISKETQKAY
YVTTFKLEVSTNGEDWMVYRHGKNHKIFHANTDPAEVVLNRVPQPVLARFVRIRPQTWKN
GIALRFELYGCQITDAPCSNLQGMLSGLLPDTQISASSSREMVWNPGTARLVASRSGWFP
GPAQPLAGEEWLQVDLGVPKMVRGVITQGARGGDAGSGATTDNRAFVRKYKVAHSLNAKD
WNFIMDSKFSLPKIFEGNTHYDTPELRHFDEVVAQFVRLYPERWSPAGIGMRVEILGCDL
PGDQKPLIRTGAPSLNCKRTTSVFPDCGRKRTPCAEDKQVMDSKPLALPSCHSCHLSFIR
QRNCTEQHTKLKSMWMYMCHRHCDSFPELNSYLYMDASLKTEQQRARLVGPVVAADTGPL
CLIFSYQLGGEAQGHLRVLSRDNHNEEAVLWTLKDDQGPVWKEGRTILPRSPKDFQVVME
GFFAHGTRGHIWIDNIQMSLSTPLTECTQPFTAFSPENPGLQVPEWNTASPSSEPPVTSV
SEKDNSWLYTLDPILVTIIVMSSLGVLLGAVCAGLLLYCTCSYSGLSSRSSTTLENYNFE
LYDGLKHKVKLNQQRCCTEA
Download sequence
Identical sequences H3DAL4
ENSTNIP00000017555 ENSTNIP00000017555 99883.ENSTNIP00000017555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]