SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DAM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DAM0
Domain Number 1 Region: 340-529
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 7.19e-78
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000264
Further Details:      
 
Domain Number 2 Region: 31-125
Classification Level Classification E-value
Superfamily A heparin-binding domain 2.88e-44
Family A heparin-binding domain 0.00000254
Further Details:      
 
Domain Number 3 Region: 126-190
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 1.57e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000193
Further Details:      
 
Domain Number 4 Region: 269-328
Classification Level Classification E-value
Superfamily BPTI-like 7.95e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DAM0
Sequence length 728
Comment (tr|H3DAM0|H3DAM0_TETNG) Amyloid beta (A4) precursor protein a {ECO:0000313|Ensembl:ENSTNIP00000017561} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLKADLAIRMFVATDSSKAIDVPTDVSMGLLAEPQVAMFCGKINMHINVQSGKWEPDPSG
TKSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHMHIVVPYRCL
VGEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGDRAMNLHDYGMLLPCGIDR
FRGVEFVCCPAEAERDMDSTEKDADDSDVWWGGAENDYSDNSMVREPEPAEQQEETRPSV
IDEIDAFGESDDVDADEPTTNVAMESVEEVVRDVCWANAETGPCRALLPRWYFDREEGRC
AQFIYGGCGGNRNNFESEEYCLSVCSSVLPTAMPSSPDAVDHYLETPADENEHAHFQKAK
ESLEAKHRERMSQVMREWEEAEREARNLPRADKKIVIQQRFQEKVEALEQEAASERQQLV
ETHMARVEALLNDRRRLALESYLTALQQDPPRPRHVFSLLKKYVRAEQKDRQHTLKHFEH
VRMVDPKKAAQIRPQVLTHLRVIEERMNQSLGLLYKVPGVADDIQDQVELLQREQAEMAQ
QLANLQTDVRVSYGNDALMPDQELGDAQADLLPQEDTLGGVGFIHPESFNQLNTENQVEP
VDSRPTFERGVPTRPVTGKSMEAVPELRMETEDRQSTEYEVHHQKLVFFAEDVGSNKGAI
IGLMVGGVVIATVIVITLVMLRKKQYTSIHHGIIEVDAAVTPEERHLSKMQQNGYENPTY
KFFEQMQN
Download sequence
Identical sequences H3DAM0
ENSTNIP00000017561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]