SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DAN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DAN6
Domain Number 1 Region: 44-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 132-174
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000484
Family Hairy Orange domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DAN6
Sequence length 415
Comment (tr|H3DAN6|H3DAN6_TETNG) Basic helix-loop-helix family, member e40 {ECO:0000313|Ensembl:ENSTNIP00000017578} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MERIPSAQPPPLSKHQADLSDVPGMDFPMYVYKPRRGLKRGEENKETYKLPHRLIEKKRR
DRINECIAQLKDLLPEHLKLTTLGHLEKAVVLLTLKHVKALTSLLEQQQQKILALQNGMQ
IGERQPPASQDRSEMFRSGFHMCAKEILQYLVNHEADGDFTPSHAIAHIQKVAAEVLQSP
VRPCSPVSPRPEEAPACHQHPPRKEMPASAPPKPSEGYGRNCVPVIQRAYAPASSEQSGS
DTDTDSGYGGELEKMESGAPQARPDYYGQESQPKRSLSDRQSSAIKQEDEEPRHKRPRAE
SLEDELLSGARGYGSYSMSPNHPPPSHPLCMPFYLIPPSAAAYLPMLEKSWYPGTVPILY
PGMGAMPKERPSPPQLMLSPRGGSPAPAMSQTPMDSPTLLQALKQVPPLNLETKD
Download sequence
Identical sequences H3DAN6
99883.ENSTNIP00000017578 ENSTNIP00000017578 ENSTNIP00000017578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]