SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DBI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DBI5
Domain Number 1 Region: 436-720
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-67
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 144-219
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.83e-22
Family Mib/herc2 domain 0.00087
Further Details:      
 
Domain Number 3 Region: 10-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 9.55e-20
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 64-136
Classification Level Classification E-value
Superfamily RING/U-box 1.11e-17
Family ZZ domain 0.0068
Further Details:      
 
Domain Number 5 Region: 946-1006
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000383
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Weak hits

Sequence:  H3DBI5
Domain Number - Region: 812-857
Classification Level Classification E-value
Superfamily RING/U-box 0.00161
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number - Region: 861-906
Classification Level Classification E-value
Superfamily RING/U-box 0.0177
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DBI5
Sequence length 1008
Comment (tr|H3DBI5|H3DBI5_TETNG) Mindbomb E3 ubiquitin protein ligase 1 {ECO:0000313|Ensembl:ENSTNIP00000017877} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTTGRNNRAMMEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDVRILDSAPTGIKHDGTMCDTCRQQPIIGIRWCAECTNYDLCTTCYHGDKHHLR
HRFYRITTPGSERVLLESRRKSKKITARGIFTGGRVVRGVDWQWEDQDGGNGRRGKVTEI
QDWSAASPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR
NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSG
NRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEA
MLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGGLERLSQLL
KKLFETQESGDITEELVKAAANGDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDV
LKLLLKHNVDLESEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVN
KGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLESGADVTITNNNGFNA
LHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASL
DIQNGNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQ
DMQDVSKLEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLC
PDPSLCKALAKCHKEKSSGQVGTRSPSLNSNIESLEECMVCSDMKRDTLFGPCGHIATCS
LCSPRVKKCLICKDQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCR
AVVERRTPFVLCCGGKGMEDDAACRANAASGNIPALQRDKDNTNVNADVQKLQQQLQDIK
EQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY
Download sequence
Identical sequences H3DBI5
ENSTNIP00000017877 ENSTNIP00000017877 99883.ENSTNIP00000017877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]