SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DBN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DBN6
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 144-254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 257-371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DBN6
Sequence length 375
Comment (tr|H3DBN6|H3DBN6_TETNG) CUB domain containing protein 2 {ECO:0000313|Ensembl:ENSTNIP00000017929} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LLMSRGCVLGNVRCLSAGAADRNHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLIV
VAEGSSVHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNVM
SIIFHSDRHVAYRGFSVGYRKDMCGGVLTGLSGEISSPGYPLEYNNNADCTWTIRVSSAS
VVTLVFLDFQLENNEGCNFDFVALFDGPTVAHRHLGNYCGAAKPPHVVTTSNNLLVVFKS
DFNIGGRGFKAYYYSGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQAAGYRVKLFF
PFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSNKLLVVLRTDR
NGAYRGFTAAYLGGK
Download sequence
Identical sequences H3DBN6
ENSTNIP00000017929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]