SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DBR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DBR3
Domain Number 1 Region: 231-553
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-89
Family Protein kinases, catalytic subunit 0.0000000862
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.46e-22
Family PB1 domain 0.0000966
Further Details:      
 
Domain Number 3 Region: 100-168
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.19e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DBR3
Sequence length 573
Comment (tr|H3DBR3|H3DBR3_TETNG) Protein kinase C {ECO:0000256|PIRNR:PIRNR000554, ECO:0000256|SAAS:SAAS00929532} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VKIKAHYRGDMLITDIPASLTFDQLCEEVKMLCSVARLQPITLKWMDDEGDPCTISSQRE
LQEALRLHRRHRRSGLLLHVFPSVPQQPGMACPGEDKSIYRGGARRWRRLHRVNGHLFQT
KRFTRKAPCGSCADSIWGLRTQQGYKCINCKVLLHKRCHRLLPLTCPMLMDPVMPSQEPP
PDDKSVSSSFPHRPNAHERTEAKTEESEDISAVVDGIGGMKLSQDLVLGLPDFELIRVIG
RGSYAKVLLVRLKKNDQMYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSC
FQTQSRLFLVIEYVKGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKL
DNVLLDHDGHVKLTDYGMCKEGIQPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGV
LMFEMMAGRSPFDIVTDNPDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKD
RLGCQVQMGFTDVQSHTFFRSIDWNQLEQKQVTPPFKPQISDDYGLENFDTQFTNEPVQL
TPDDEDVIKRIDQSEFEGFEYINPLLLSMEESV
Download sequence
Identical sequences H3DBR3
ENSTNIP00000017956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]