SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DC09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DC09
Domain Number 1 Region: 1356-1460
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-24
Family Ankyrin repeat 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DC09
Sequence length 1632
Comment (tr|H3DC09|H3DC09_TETNG) BCL6 corepressor {ECO:0000313|Ensembl:ENSTNIP00000018052} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
TKPNPELRQGNHVTQNMVDARLTPLAAMGLDRSALMHNSLRLHSGVVYPGIRALSGEKSR
ENPSIPLAYNRDGLPELIYKPDASLESQKATNGYLGLYKGTPPSLHKPMLVPGAEGLGLE
RRVGPGEKASEMGLTSAGGSYLRLPWLNPYPEASMYPFIDTTKYAALNMYKASLLSQPSP
YLPQHLAYPSLCAAQGGSVNPAAAASAAERLYYMPPYPAPPISSPLVAPPMRIPTVTVAP
TSLVHCQDKGLSVAPPFPQQLHQPSPHTQHLQKSASSNSNTASNSANGTTGAIGSLSTDG
SRLSQPPPPPALIDNSLDLQRPVARLGQPPTSSTASISASSSATQSIPHPFFVSSMASEQ
SSPARPSPHKHRTRDGAPEQRSVGDERRSSRSPSKPSFERSVHQPQPTKDSAEKPLDLSG
RILEFGLPTNGFPVKMESIAQGARYGLPPSRELLKENPSLSPSSNPHSVVPERPEMISTL
HSSWVVPSQAPSSAKGSPPSVIKHKSLERVHPQQRSSSCPRIGEPPHNGSSTHSSLSSSR
ALSPKTTNDWVRHSPSRMEQTTVKGHHREGTEKSTHTIKRAETTSEGPSFKRPCLENGHP
PGHLYLPQNDTYLNHSLAYANRYLHYPVADGMTLHSMPITGKGPVYPHPGLLGSSSLYPT
HLTAKHPLSYHNLPAGSGGEYLTYNSQEMAHPLMHAPPDKMPDRGDVGLKTRGQERSRGV
IEDCGGQRDLNMGKDLGEATQFKLDKQMGTYAQSGSQCKGASSVPSREKIVCIDLVHSDT
DMESTPAGSKQLSAETGGKVNQKECTNQNLTEPKHHLSHPYSAHQGQSPTVKPNHPDRPT
DAPTGKARSLPASSSEAGSAGLTSTLSPTSPGLSAQVEEIPEEPICSPEPEDPDQSTLRC
ARTSGERSSEDGSQSSSKNCRRSSLAKRIANSSGFVGDRFKCVTTELYADSSKLGREQRA
LQQRAMMRFSELELKEKEGGGVCVTASAAAAAGRELADTQHGEQALEHSQYSSRQGETEE
CSTAAGFSQPCWREAGSSLIYASFSNVFFPPSFFFNPRFTFFLSSALRVERERLLSGSSS
LTACVQRAAPISPWMRRALVSRWCFSAASSGLIARGQRYERLQDRGRHADGAHMLREVKC
DTYAHQTPALTQYSVLLADDFRVQTRANRRPNHPTLLRLQSLKIRGTVLSRSTTHPADTA
HTGCSFSFASRASAHEEKPSATYNTQAMKIHTQQHTRALYQERAPDAAAPQGVKCLSDAL
IAGERSLPNTCSHSRSQADTLLTLVHFRPLHPALEFPLWPQIRRPPFPFRSSAHLAPPLN
PSSPLPASPSACFLIFACHFFPLPPLHRSTLRKKEREGGREVVLYCLENRVCDVNHRDYA
GYCALHEACARGWLTIVQHLLDYGADINCSAQDGTRPIHDAVENDHLDVVRILLSYGADP
TLATYSGRGLLKMTHSETMEHFLTDYFADLQGRSDDDPGLYWEFYGSSVCESSEEGGIYD
VLADPPGPFEFEFSDRPLLPCYNIQVSLSQGPRNWLLLSDVLRRLRMSARSFRQAFPHME
VVTVAEAEFYRQASLSQLFSCPEELEGFHPDSKDLLDLVEDSTELATLLGSTLECLDDHW
DHPADALKDRIK
Download sequence
Identical sequences H3DC09
ENSTNIP00000018052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]