SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DC82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DC82
Domain Number 1 Region: 26-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.29e-25
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DC82
Sequence length 429
Comment (tr|H3DC82|H3DC82_TETNG) Ankyrin repeat domain 33Aa {ECO:0000313|Ensembl:ENSTNIP00000018125} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
DSGSLISEDSLFPDYESEDKNADPAKTLYEACIRNDPTALCRILERGITKEEAMELDING
RNGLMVAVSKGFIDIVTTLHVCPLIEINHQDNDGNTALMIAAQAGFVNILNYIINFYAGV
DTEVRDPRGFTALIKAGLQGREECVAALLMHGADINAMDLVKGRNLKDWVLKTGGFETFK
RVRRLQARPIGEQFCMSYVPEWPDLKQLVAKATATKTATQKLRQRLKDGFSFSFPHDPED
NGVMDHMVRMTTSIHSPLIATGCHPLCPSSPPEIGKQRFAVPELLEKYSCKEAEESTVSH
NKGSVTSASPTAVSATSVSLTSCCQNSGHRDSTAGSGGGGMRGLMPRSVAHRNSIFPSGC
IPKIEVTKSSGPTPKKEKKKKRQKGYLEPPVWKYKEAKAIKCRQLSTGESQEENETFSEK
QEKRSENRF
Download sequence
Identical sequences H3DC82
ENSTNIP00000018125 ENSTNIP00000018125 99883.ENSTNIP00000018125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]