SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DCH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DCH9
Domain Number 1 Region: 304-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-23
Family Laminin G-like module 0.058
Further Details:      
 
Domain Number 2 Region: 122-231
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000103
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000842
Family Cadherin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DCH9
Sequence length 939
Comment (tr|H3DCH9|H3DCH9_TETNG) Calsyntenin 1 {ECO:0000313|Ensembl:ENSTNIP00000018222} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VNKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTLTEEGEICGFRIH
GQNVPFEAVVLDKSTGEGVIRAKDKMDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATV
HIQVNDINEYSPTFKEKTYKATVLEGKKYDSILKVEAVDADCSFQFSQICNYEIVTPDVP
FTVDKDGFIKNTEKLSYGKERMYKLTVTAYDCGKNRASEDVLVKISVKPTCKPSWQGFSK
RIEYEPGTGSLGLFPSVHLETCDEPITSIQANVELETSHIGKGCDRDTYSEKSLHTLCGA
SSGTVELLPAPSSSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPDGLVSTSLKEPFTISV
WMRHGPGAHEKETILCNSDKTEMNRHHYSLYVHNCRLILLLRQEPSEAENYKPAEFHWKL
DQVCDKEWHHYVLNVEFPTVALFVDGTMFEPFLVTEDYPLHASKLETQLTIGACWQDASG
HENDSDFSPRLAGKGGNARMAQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPE
EVTSAVKVEFNPSQSSLTVEGDDIDAFEKVMQHISYLNSRQFPTPGIRHLRISTTVKCFN
GEPCVAVPDVEGYVMVLQPEEPKISLSGIDHFARSAAEFESQEGVTLFPELRIVSTITRE
VETDSESEVAAGADDDPTVQETVVSEEIMHNLDTCEVTVVGDQLDGEHESLELDVSQLQQ
RGLEMSASNLGLVVTAGVNSMANYEQLLHLIRYKNWHTEALFDRKFKLVCSELNGRYVSN
DFKVEVNVIHTANPVEHANNAMMQPSFINPVHHASVDLSGHNLVNAHQASVVPSAATVVI
VVCVSFLVFMIILGVFRIRAAHQRTMRDQESGKENEMDWDDSALTITVNPMETYEDQHSN
DITSAESESSEDEEGAEREDQQGASRQQQLEWDDSTLTY
Download sequence
Identical sequences H3DCH9
ENSTNIP00000018222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]