SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DCV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DCV1
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-72
Family Kelch motif 0.0000393
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DCV1
Sequence length 599
Comment (tr|H3DCV1|H3DCV1_TETNG) Kelch-like family member 24a {ECO:0000313|Ensembl:ENSTNIP00000018344} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MVLILGRRLNREESGIRDSPAIKRKVFDVDSKTLASQEVLDFCSGSSHSDGILQVFNEFR
DCRLFTDVVISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMDSF
LTYVYTGRAKITTENVQFLFETSSLFQINTLRDACAKFLEDQLDPCNCLGIQRFADVHSL
KQLAGRCRSYALANFSEVAQHEEFLDLHREELEDYIGSDELSIRKEEVVFEAVMRWVYSD
VEQRRPMMKALLHHVRLPLLHPNYFVQTVEGDQLIQNAPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGFSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKALAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWMYNSQLNLWIRVASLNKGRWRHKMCVLLGKVYAVGGYDGQSR
LSSAECYDSFSNRWTEVAPMKLAVSSPAVASCAGKLFVIGGGPDDDTCSDKVQCYDPEAD
TWLLRANIPIAKRCITAVSLNNLIYVCGGLTKSVYCYDPSQDYWIHVVHTFTKLESCGMS
VCNGKIFILGGRGESGEATDTILCYDPATGIVMSIAAMPRPISYHGCVTIHRYTDKYHR
Download sequence
Identical sequences H3DCV1
ENSTNIP00000018344 ENSTNIP00000018344 99883.ENSTNIP00000018344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]