SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DD54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DD54
Domain Number 1 Region: 56-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000105
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Weak hits

Sequence:  H3DD54
Domain Number - Region: 178-254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0837
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DD54
Sequence length 320
Comment (tr|H3DD54|H3DD54_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000018447} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSLSARTQLLLFLISLLSIVGRSRFIEEDDDSDGLYSLLNMDQKRQSADFIFRRPLRCLD
MLATDGYFTFVASQPQLACAAFVIAEPDEVISLELQDVSIDCTAGDFIKIFDGWVLKGEK
FPSRQDHPLPLHQRYTDYCSSEGAGATSRSSQNVAMVFFRVHGPGSGFTLAVKKLHNPFP
CNIMSQSPEGSFTMVIPHQRRNCSFSIIYPVEIRLTALSLGQAKSNDIGLQRQVWSDCSG
SGDYVELLGGDGVDTSQMFPVADLCFSLSGLAQMKIGCDNSVVRLVSAATTSTACPFSTD
CWSSTSSPGAERTVCLTSAL
Download sequence
Identical sequences H3DD54
ENSTNIP00000018447 99883.ENSTNIP00000018447 ENSTNIP00000018447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]