SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DDB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DDB1
Domain Number 1 Region: 110-214
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-35
Family Link domain 0.0039
Further Details:      
 
Domain Number 2 Region: 220-303
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-23
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 2-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000438
Family V set domains (antibody variable domain-like) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DDB1
Sequence length 305
Comment (tr|H3DDB1|H3DDB1_TETNG) Hyaluronan and proteoglycan link protein 1a {ECO:0000313|Ensembl:ENSTNIP00000018504} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
KVLANLGGNATLPCRLPSKDTMFFGAAGIRVKWTKVADDEAFNQDVVLSMGFHKRTFGSF
EDRVYMVSNDNEDGSILITNIAMQDAGKYHCELINGMTDVTQEVYLEVQSVVFPYHLRLG
RYHLNFTKAVLACQEQDAKVASYDQLLDAWRGGLDWCNAGWLSDGSVRYPITKPREPCGG
ANITPGLRSYGWQNRRSLFDVFCFASRLKGTFYWLVQPERLTFAEAVQACLDDGAEIAKV
GHIFAAWKLEGYDRCDAGWLADGSVRYPISRPRKNCSPTEAAVRFVGFPDKKQRSYGVYC
YKAQQ
Download sequence
Identical sequences H3DDB1
ENSTNIP00000018504 99883.ENSTNIP00000018504 ENSTNIP00000018504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]