SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DDP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DDP4
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.53e-82
Family BAR domain 0.00055
Further Details:      
 
Domain Number 2 Region: 400-516
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 260-363
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-28
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 616-734
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.54e-26
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DDP4
Sequence length 784
Comment (tr|H3DDP4|H3DDP4_TETNG) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 {ECO:0000313|Ensembl:ENSTNIP00000018637} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MKITVDFEECLKDSPRFRATVEEVEGDVCELESKLDKLVKLCISMIDAGKAYNAANKQFV
NGIRELAQQSTTDEVIESSLTKFAESLQEMINYHTILFDQAQRSIKTQLQTFVKDDLRKF
KEAKKQFDKVSEEKEAALIKNAQAPRNKQHEVEEATNILSATRKCFRNIVLDYVLQINVL
QSKRRSEILKSMLSFMYAHLTFFHQGYDLFSELHPLMKLLGGQLDQLVVDAAKEKRDMEQ
KHCTIQQKDFSNDDTRLEYNVDTDNGIAMEGYLFKRASNAFKTWNRRWFSIQNNQLVYRK
KFKDTPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCILQADSEKLRQAWIKAVQNSI
ATAFRDKGEDAEKLDRKSSTSTGSLDSGGEPKERSLKGESALQKVLAIPGNACCCDCGQP
DPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNGVINQIYE
ARREELGARKPQPGDPRQEVESYIKAKYVERRLVRRPSDEQLRTKVVSLSKQEKRLSTSS
EHLPPRPPPPTPKLRPGSNASVKSADSGIQNSADGSREVLTDVPADGNNLPEAGRTPRAG
ERVFYEPKEYSPGLQLYWASFARSLPDMAEALAHGAEVNWVNTEDDKRTPLMMAVQGGSL
VTCEFLLQNAANVNQQDAQGRGPLHHATMLGHTGQVCLFLKRGANQNAADIDERTPLTIA
VEAANADIVTLLRLAKMNEEMREAEGPYSQSGDETYQDIFQDFTHMASNDPDKLNRYQQY
DPQS
Download sequence
Identical sequences H3DDP4
ENSTNIP00000018637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]