SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DDQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DDQ1
Domain Number 1 Region: 689-961
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-71
Family Protein kinases, catalytic subunit 0.00000724
Further Details:      
 
Domain Number 2 Region: 402-681
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-49
Family Protein kinases, catalytic subunit 0.0000679
Further Details:      
 
Domain Number 3 Region: 245-360
Classification Level Classification E-value
Superfamily SH2 domain 8.44e-18
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 154-260
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000209
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 5 Region: 30-146
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000262
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DDQ1
Sequence length 974
Comment (tr|H3DDQ1|H3DDQ1_TETNG) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
IRYYFPGWYSGGASRAYRYGVAKGSESPVFDDCVMSYLFSQWRNDFVNGFVKIPSSHEIQ
EECLGMAVLDMTRTAKERQLSPLDIYHTMSYKSFLPKEIRAQIQDCNFLTRKRIRFRFKR
FIQQFSQCRTTVRDLKLKYLISMESLEKAFYTETFQVRELSRGQLIMTGCSNGIQWCQEK
LKDSDEELQILCDFPDVTDISIKQASKEGATESRVVTINKQDGKNLELEFPSLSEALSFV
SLIDGYYRLTTDAHHYLCKEVAPPRLVEAITSHCHGPISLEFAINQLQKCGNKQGLFILQ
CSPKDFNKYFLTFPVEVYGTVEFKHCQITRSECGQFNLSGTKRNFSSLHELLSCYKNETV
RSDSVVFQFSKCCPPKAKERSCLLVCRTNKGPEVPLSPSTNRHNISQMVFHKIRKEDLEF
NESLGQGTFTKIFKGVRKELGDYGLMHQTEVVMKVLDQAHRNYSESFFEAASMMTQLSHV
HLILNYGVCVCGEENIMVQEYVKFGSLDTYLKKNKNSVNILWKLEVAKQLAQAMNFLEEK
NLVHGNVCAKNVLLIREDDWRAGNPPFIKLSDPGISITVLPKEILVERIPWVPPECVNDP
ANLSLAADKWSFGTTLWEICSGGEKPLASLDNTNKTLFYEDRHQLPAPKWIELANLITSC
MDYEPTFRPTFRAIIRDLHSLFTPGWFSNMVLFKQQLGKGNFGSVEMCRYDPLQDNTGEV
VAVKKLQHGTAEHIRDFEREIEILKSLQHENIVKYKGVCYSAGRRNLRLVMEYLPFGSLR
DYLIKNKERIDHKKLVHYSSQICKGMEYLSGKRYIHRDLATRNILVESESRVKIGDFGLT
KILPQDKEYYMVREPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTHSSRNSSPP
TVFMSMMGNDKQGQLIVYHLIELLKSGSRLPQPLDCPTEIHEIMEQCWDNDPYLRPSFKE
LALSIDLFREHKEF
Download sequence
Identical sequences H3DDQ1
ENSTNIP00000018644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]