SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DDW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DDW5
Domain Number 1 Region: 7-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-78
Family Protein kinases, catalytic subunit 0.00000000113
Further Details:      
 
Domain Number 2 Region: 367-669
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-74
Family Ankyrin repeat 0.0000183
Further Details:      
 
Domain Number 3 Region: 1293-1405
Classification Level Classification E-value
Superfamily DEATH domain 1.7e-18
Family DEATH domain, DD 0.002
Further Details:      
 
Domain Number 4 Region: 687-709,780-890
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000405
Family Atu3015-like 0.045
Further Details:      
 
Weak hits

Sequence:  H3DDW5
Domain Number - Region: 683-757
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0132
Family Atu3015-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DDW5
Sequence length 1441
Comment (tr|H3DDW5|H3DDW5_TETNG) Death-associated protein kinase 1 {ECO:0000313|Ensembl:ENSTNIP00000018708} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTIFNQENVEEFYEIGNELGSGQFAVVRRCRHRSTGVEYAAKFIKKRRSKSSRRGVSRED
IEREVNILKEIQHANIITLHEVFENKAEVILILELVAGGELFDFLAEKESLSEDTQFLKQ
ILDGVFYLHSKQIAHFDLKPENIMLLNRSVPHPRIKIIDFGLAHKIDFGNDFKNIFGTPE
FVAPEVVNYEPLGLEADMWSVGVITYILLSGASPFLGDNKQETLANVSAVDYTFDEEFFS
NTSILAKDFIARLLVKDPKKRMAIQDSLQHPWIKPKDTQQALSRKESAVNMEKFKKFAAR
RKWKQSVRLISLCNRLSRSFLSRSNISVARSDDTLDEEDSFVMKAIIHAINDDNVPGLTH
LLGSLNSYDVNQPNKHGIPPLLIAAGCGNIQIIEVLMRKGAEIQAGDKNHQSGANAIYYA
ARHGHVDTLKFLHEKNCPLDIQDKSGETALHVAARYGNVDVVGYLCSIRANPDLADREQE
TPLHCAAWHGYSTVARALCQAGCRVDAKNREGESPLLTASARGFVDIVECLVEHRANLET
CDKDGHTALHLAVRRCQVEVVRCLLRHHCHLDQQDRHGNTALHIACKDGNLPIVIALCNA
KANLDLPNKYGRTPLHLAASNGSLEVVRHLCLAGVNIDAVTNDGKTAEELANADHHEQIV
SLLVRLKKDNHKLSYIQQLRPTQTIQPRKLKLFGHPGAGKSTLLESLKCGILRSFFRRRR
TRMTNTARQPNSPVNSKPPVSVSISNLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPVHS
TLSTADEQATKAIDIQHANIHSVGDFSVWEFSGNPVYYCSYDYFAANDNTAIHLVLFSLE
EPYETQLSHVTYWLNLLKALTLPQDNIGFGGRIQQPLLVVLVATHADLADIPRAFSGEFT
YDKEKVLLKEVRNRFGLDLQISEKLFVMDAGASNSKDLKLLRSHLLELRSSIISKCSPMT
QLTERLLNTLPAWRKLSGPNQLTSWQQFVSDVQEHINPLVSQDHLRALTMQLHSMGEINI
MQSETVQDVVLLEPRWLCSSILGKLLSVETPKAIHHYRGRYRLEEVQALVPESDVEELLQ
ILDAMDICARDTTNPFMVDVPTLIKTSGLHRSWTEEDEEDEALIYGGVRLVPAEHLTPFP
CGLFHKLQVNLCRWSHQQKSEEEGGDDFDGDIHLWTNGAKVSQTGVEALVLLVNHGQGVE
IQVRGHDSERAKCYTLLDTICSITENLLTSTLPGLLTAKYYLSPQQLRERHTPIMIYQPK
DFFRAQAQRETSLTNTMGGYRESFSSILSFGCAEVYQQGTLGTDVHISDVPLLARRKLCR
MLDPPDAMGKDWCLLAMNLGLTELVAKHSNGTSNGAAEPDSPQPSPTAALLQEWSGRADS
TVGVLMGKLRELGRRDAADFLLKASPVFRVNVEAIGRAANGYPPICNGGTSYNSISSVIS
R
Download sequence
Identical sequences H3DDW5
ENSTNIP00000018708 99883.ENSTNIP00000018708 ENSTNIP00000018708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]