SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DDY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DDY9
Domain Number 1 Region: 375-476
Classification Level Classification E-value
Superfamily E set domains 1.4e-25
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 159-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000112
Family B-box zinc-binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 19-78
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000128
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  H3DDY9
Domain Number - Region: 215-297
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00602
Family Apolipoprotein A-I 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DDY9
Sequence length 561
Comment (tr|H3DDY9|H3DDY9_TETNG) Tripartite motif containing 45 {ECO:0000313|Ensembl:ENSTNIP00000018732} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RLENESEPERTGPSAKPRAVCAVCKRLYRDPKILPCLHTFCSECIGRLEPFSVGGPPREE
RPAVTVLCPACDSEVDIPPSGPGGLSTDHLALDEVFLETLEADGPLGCDLCGEGGAESRC
EVCCVNLCGFCCQAHRRQKRTASHSVRCLGELKSCGPLRRPVLCGLHPGQELRLFCQPCD
LPVCLECAATLHRDHHCCPTRDIIHRHGDRIRELVSGRLRPHLEQLKDSLEKVEKSQEAL
QARVDATANEVRAFARGYASAVEAHCLSLLHRLEELHVQRRNQLHLQRAQLRQALLDVQG
GVDFAERLLTCGSDAEILSAKGVTLRRLSSLAEGGRGARPASVAPDDGSSIGFAASEAAG
QVEGFPVVGVIVSKTVDVSKCTIEGEDLRRCREGEPAHFLVVCRDSAGEPMTRGGDHVMV
SVVHKGKENCKAETTVVDNSDGTYSVSYTPDQEGAYSVWVCVRAQHVQGSPFALTVSRRT
RRHGGTFHCCCFCSSGGSKEALCGCPGTMPGGFRGCGHGHKGHPGKLHWSCCGSTVKNSE
CLPQSVLEAVSPRSHLRTVEL
Download sequence
Identical sequences H3DDY9
99883.ENSTNIP00000018732 ENSTNIP00000018732 ENSTNIP00000018732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]