SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DEB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DEB7
Domain Number 1 Region: 36-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.7e-34
Family Ankyrin repeat 0.00087
Further Details:      
 
Weak hits

Sequence:  H3DEB7
Domain Number - Region: 273-314
Classification Level Classification E-value
Superfamily SOCS box-like 0.000109
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DEB7
Sequence length 319
Comment (tr|H3DEB7|H3DEB7_TETNG) Ankyrin repeat and SOCS box-containing 12b {ECO:0000313|Ensembl:ENSTNIP00000018860} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLILGQAVNMSLMDISKIFSLLQPKEEDERSERSQALNAAVSADDVVLLSDLLSQESYRK
AVNARSGWGIPVTPLRTAAALGHLRCLEVLLEHGAEVDSLDVKAQTPLFTAVSGKHLDCV
VALLKAGADPNGSQYNNCSPVLTAAREGDVDVLRELLRFGAEADVKPKVPEWATATACRG
PLYISAVYGHLDCFKLLLLHGANPDYNCTDEKMLARIKQPKTVLETCFHYGCGEEYVQLL
VDFGADVYLPTLIVDKFMKQNEALALLLKERVCPKTLMTQARLSIRRYIKLPDKEAGIDW
LDLPQMLRNYLKHNTTELL
Download sequence
Identical sequences H3DEB7
ENSTNIP00000018860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]