SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DEM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DEM4
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-17
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DEM4
Sequence length 601
Comment (tr|H3DEM4|H3DEM4_TETNG) Ankyrin repeat domain 13A {ECO:0000313|Ensembl:ENSTNIP00000018967} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSTANISEDIRAKFPLHSAVWENDYRKLEEQIQIPQNDTEAVDPRGRTPLHLAVSLGHLE
SVRVLLRHNASVTKENASNWTVLQEAVSTGDPEMVQLVLQRRDYLKASAALGGVPELLAK
IRESPDFYMEMKWEFTSWIPLLSRVCPSDVCRIWKSGANLRVDATLLGFENMTWIRGRRS
YIFRGDDSCAELMEVNHDNEVVDTERFNISQEMEDVTLESMQPAEQEVAKRLTTPIVNTY
LDTKEIAFERNKSGIWGWRTEKTEVVNGFEAKVFSVNNVNVVIRTRTEHLTDEEKARIKS
ERNILESLLGTVEQHISAQGDMTMEYATATNPTAITPEEYFDPDFELGNRDIGRPIEMSV
RTQKFKGTLWMSEDHPLSLVEQVTPIIDLMARTSSHFARLRDFVTLKFPPGFPVKIEIPL
FHVLNARITFGSVNKCSTDAELKTTPAGTPTPTAEDEEAADLSPFQVCPSVFEVPPSYHR
RGGSRHTPVSSNDEELLQYAIHQSLLESRRASGQEVIWEDTDADVVTRSRSDSNSRSISE
GALVDYGDTSSPSSSMSASSPDTELRLAMELSAQAQAEEDRIRKQEEEELERILQLSLTD
K
Download sequence
Identical sequences H3DEM4
ENSTNIP00000018967 99883.ENSTNIP00000018967 ENSTNIP00000018967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]