SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DET3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DET3
Domain Number 1 Region: 99-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000141
Family Ovomucoid domain III-like 0.00029
Further Details:      
 
Domain Number 2 Region: 263-317
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000043
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 3 Region: 192-240
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000388
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 27-70
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000942
Family TB module/8-cys domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DET3
Sequence length 320
Comment (tr|H3DET3|H3DET3_TETNG) Follistatin a {ECO:0000313|Ensembl:ENSTNIP00000019026} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MFGMLKHHLHPGVLLFFVWLCHLMEHQKVQAGNCWLQQGKNGRCQVLYMPGMSREECCRS
GRLGTSWTEEDVPNSTLFRWMIFNGGPNCIPCKETCDNVDCGPGKRCKMNRRSKPRCVCA
PDCSNITWKGPVCGTDGKTYKDECALLKAKCKGHPDLDVQYQGKCKKTCRDVLCPGSSTC
VVDQTNNAYCVTCNRICPEVTSPEQHLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKC
IKAKSCEDIQCSAGKKCLWDARMSRGRCSLCEETCPESRTDEAVCASDNTTYPSECAMKQ
AACSLGALLEVKHAGSCNCK
Download sequence
Identical sequences H3DET3
ENSTNIP00000019026 ENSTNIP00000019026 99883.ENSTNIP00000019026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]