SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DET8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DET8
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-29
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 183-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-27
Family Laminin G-like module 0.0058
Further Details:      
 
Weak hits

Sequence:  H3DET8
Domain Number - Region: 1420-1467
Classification Level Classification E-value
Superfamily Cadherin-like 0.0288
Family Cadherin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DET8
Sequence length 2181
Comment (tr|H3DET8|H3DET8_TETNG) Si:dkey-193c22.2 {ECO:0000313|Ensembl:ENSTNIP00000019031} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
ASFYGDGFVQLKAAESSDRNTLRARFRTSSTNGLLFLAAGQADHLLLELHAGRLQLKLDL
GSGEHVLHSEKGTQLNDLAWHTLEVRHARQDLALTVDRNSHSRLTLPGPQYDLHILDGLF
VGGSGGLERPYLPRDPSGFRGCMEEVVFNEHDLLSSLRPYAGFKSVHEVSLGCSPQFFAT
EEDPISFFSSRAYMSLPAWNAQREAAFQCAVLTSAKEGLILFNSAREGDFVAVEIQEGLP
VAVIGRGGSRTELRSLTFISDGKWHFIKLNFSSKNLVLTVDGEIVKNSIRTRSKGFQLRG
HLYVGGVDDGTRAEVRKAGLLSVSGKRARGGSFKGCLKNIEVNRVKMGLSNAVVTRDLSV
GCEPAKEPEPATTVSPTTPSGSLLHFTTTPSLHMSTLARGLDRRYGSDFIQLRNLVVQEG
GRASLEAKHVKVHLDFKKLGIRQSQIMFRVEEQPVHGQIRLDVDPDQEENTFSMLDLWHG
RVMYIHGGSEEPEDFFTFSVYSSSRREVPDYLKEKKLYRYNITVTATNDAPELSLPEGNL
FVLLENTKKRLTTDVLKATDIDSNNADLVFSVLGNLNANAGYLEIEDSPGTAVASFSHVD
LEELRVYYVHTGVRNSRIVLRVSDGDKVSNTVVLRVMAVALEYQVANNTGIEILQGEAAF
IGSNQLAVRTNAVRQAVDVRYDITEAPQYGELQRLHSSGEWRQTDSFSQRLLEKERLRYV
STFQDVQTSSVADRFRSRVTVAGRETTEVLFPITVKWVRYHLVRNSALEVDKARKVTLNS
DCLYATTEGVSLTEDDLHYRVLTLPKKGNLLLEATVLGKNSTFSQADVTSSKVHYQLVDR
PFENTTDRFKFQLVSRHAQSQNYDFQFSIKADADSVFIRNHGLSVLEGESKLITKDQLFA
ETLSTKDLYYTITSSPKHGKLARISLSNSNASYDNIVTFSNQDVLEERLLYIHDDSESNH
DSFAFVASISEGFKTSTTDLDVGTKEGTFDISIQLVNDQKPVRLIDKVFQVVRDGQKLLT
VEDLRHHDPDSDFDDSQLIYTRRGIPVGDLVLVNDTTQRLFQFRQKDLEERRVLFIHKGA
SSGRFVLFVSDGKHFISSLLDISAHEPFLKVGNNTGLLVQKGHSVTIHTANFSVESNLDI
RDDQEVSFSLDEAPRHGELGLNQTKVDGFSQSDLREGLISYRHDDSGHLADSFNLTVRAK
GLRLAVRIGVKVYLESHQRPPVLQQHSTVLVEEGKPVKIDETILEVTHEDNLPSEIVFTV
GVVPSHGFLRRFANERYVGTKMSALTTFTQEDINQGNVQYVQAEPNKASDAFVLDATNGV
THVRDIRVSVDIIPRLIPLHVTNLTLQEGASRALSQDVLRVTSPHFSGINFLYSVIEPPQ
HGHVEHSRHPGVAITSFTRRQVEQELIYYVHDGSESVTDSFTVGANDTGLRKHSGGQTIH
IQLTAVNDEPPVITANRVLRVWVSSVTEIRPEDLRAQDLDSPPEELHFMVTPPSNGHLAL
KSAPMVAVLNFTQAHIERGQLLFVHKDAGAMSGGFNFQVNDGVNFTPRQIFSITAQALVL
SLERNRPLKVFPGSSATITSEDLLAVTNDFSNTSNRVITFSVIRQPKLGRLAMRRPDDST
SDVSTFTQEMVNRGEVVYIQSPLESVGWEAKDYMTFSVSSPPASLDSQTFRIDISYENTG
PEHNTVLLANTGAVVTEGESVVIDKSHLDASNLMSKLPAAERSSHEVWFQVLSLPQHGVI
VVGERNLTKEKPNFSQFILNKYGITYLHDDSETTWDSFVFSVWVNPKGKTAQRPQDDGEV
VEERFNITVIPVNDQPPLLKTKSPGLRLVQGDTVALTPESLRVEDLDDPPDHIHFSVISE
PNNGYLALVGKWNESIQAFTQAQINNQSVYFIHDGSAGSGVFYFSVTDGHHKPVYKLFDL
EVTEITISLVKHTGLRLQQGNTSVPLTQENLAARSNGKNVSIHYLITRPPLFGKLLKENL
EVTEFEEEDLKSGRLSYHMTSLASSEDSFEFTAFTSEANLTGQVLEVTVTPLIQVGEGVR
IPNGIAVALTSSVLNASELAEICGSDPVFEIMTHPKYGKVMWPKPQKSQESVLAQSFTFQ
EVVQEKVALELSANLTQVQELNDSFVFLLKAANVQPAKGEFHFTVVPYDPALPLPTKAPA
SATVPEPQTTTTKPSNGTQSP
Download sequence
Identical sequences H3DET8
ENSTNIP00000019031 99883.ENSTNIP00000019031 ENSTNIP00000019031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]