SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DEX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DEX8
Domain Number 1 Region: 163-374
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.17e-49
Family Reprolysin-like 0.00077
Further Details:      
 
Domain Number 2 Region: 461-518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000484
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 835-894
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000196
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 782-838
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000628
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DEX8
Sequence length 894
Comment (tr|H3DEX8|H3DEX8_TETNG) ADAM metallopeptidase with thrombospondin type 1 motif 20 {ECO:0000313|Ensembl:ENSTNIP00000019072} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=ADAMTS20 OC=Tetraodon.
Sequence
LHYRIDAFGERFHLNLTAHSDFLAPSYTVVHLGAEERNATERSDMRHCFFRGHVNGRSDF
PAVLSLCTGLVGTFTTQHGEYFLEPLLKATGEEYDEEHNKPHLLTRQGGPGTAKCGENKG
FCPVSADWARLELAVIDCAAVRMAVGGETRHPRPPHRQKRFLSYPRYVELMVTADAKMAR
HHGPNLEHYILTIMSVVAAVYRDPSVGNLINIMIVKLIVVHNEQEGPTVSFNAATTLHNF
CVWQQGQNVQDDSHPSHHDTALLITREDICRAKDKCDTLGLAELGTMCDQYRSCSISEEN
GISASFTIVVQPSHMFNMPHDDNPKCREAGVKHQYHVMASTLNYDTNPWTWSKCSRKYIT
EFLDTGYGECLLDEPVGRTYELPTLLPGQIYNANRQCELMFGPGSQICPYLKQCKRLWCT
SAEGDHKGCRTQHMPLADGTDCGHGMHCKHGMCVNKELDLQPVHGEWGPWGPYSVCSRSC
GGGTRSTSRDCNKPEPRNGGRFCVGRRMKFRSCNTEPCPRGRKDFREEQCSQFDGKHFNI
NGLPPSVRWIPKYSGILMKDRCKLFCRVAGTTAYYQLKDRVIDGTPCGTDTYDICVQGLC
RQAGCDHVLNSKARNDKCGVCGGDNSSCKTMAGTFNDAQYGYNTVVRIPAGATNIDIKQV
SYSGKPEDDNYLALSDSQSNSVLNGNFVVAMFKREINFKGTVIEYSGSDTKVERINCTER
IEEELILQVLCVGNLYNPDVRYSFNIPIEEDKEQFVWDPSGSWLECSRICHGKNSAWQPS
LCPCGKWRAGEWSACSSTCAGGFQRRVVVCQDANGRSNSYCDERVKPAESKSCDSGPCPL
WNYGVWGECTQTCGGGRKTRLVVCQRPSGQKLNDYNCDVLDKPPDVEQCNLQPC
Download sequence
Identical sequences H3DEX8
99883.ENSTNIP00000019072 ENSTNIP00000019072 ENSTNIP00000019072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]