SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DF58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DF58
Domain Number 1 Region: 17-125
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-29
Family Ankyrin repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 163-222
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000169
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DF58
Sequence length 387
Comment (tr|H3DF58|H3DF58_TETNG) Ankyrin repeat, SAM and basic leucine zipper domain containing 1 {ECO:0000313|Ensembl:ENSTNIP00000019152} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
WSVLMACITASAQEDRITRCVELLLSRNADPNVADRSQMTCLMLAAKRGHAKVINLLMVF
GAEINAQDSYGYTALSIAVQHRRQEAVLKLLQLGADKTIRTNTGKCPADLAAIFKNTEMS
KILASSQPISASQASSSMENTLSQFFATSGEVSSAKECGRKLDELQLLLHGLDLGSLTDI
MAKNDITWSHLLSMDKEDLEEIGVTDPGDQQKVLDALRQMNLGKVDLETIDRFGGADSGC
ERRREFATSRGARSCATSXTIQDVIGRIPCHPSKIAFALDPEKEAQTLCNQLVIQTGDLQ
KEVTCLRKLLCQVAHTHTHTHAHTHPGELQQLDHEECCQPPPPEPCGPWGRQVLSGAALG
VLGATCLLVLYGATSGKLNLRVCRNPC
Download sequence
Identical sequences H3DF58
ENSTNIP00000019152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]