SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DF60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DF60
Domain Number 1 Region: 622-651,682-874
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-47
Family Ankyrin repeat 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DF60
Sequence length 1597
Comment (tr|H3DF60|H3DF60_TETNG) Cortactin binding protein 2 {ECO:0000313|Ensembl:ENSTNIP00000019154} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MASEGASGEHPPPVQTLANAVLGGVDTKYEFNMDNLSKPELLTLLSIMEGELEARDLVIE
ALRAQRKEVFLQERYGHYNLTDPFLALQRDFESGLPGGDKERRALGSSPISVLEAVMAHC
RKMQERMSAQLAAAESRQKRLEMEKLQLQSLEQEHRKLTAQLKDEREKNKHIVMMLVREC
KQLATRVVEESQRFDELQARLDEESRASGRLQEELAAERQRGQQMEAKMEKQLSEFDTER
EQLRARLGREEAESLSLRQQVEQLRTEPGDGKDGAPAAAAVTPPKPEAFTSVSVATEPVG
SRTASCQTDPPPAEAEVPRKNPLTIPVKPTPANYVGLSLPKTTGRGIIHSSSGGLAQTEN
GSEGQAPHGLPSGVSPRVQAARYKFQEQDQNGTASQSPPARDLSPTNRDNFAAKQQARHT
VTQVLSRFTSPPAGGAGPLRPGLPHSASEGGPFPGRLGHPIGLKSPTVGRIDRGNPPPIP
PKKPGLSQTPSPPHPPIKVVGDSSRTPAAGLKPATPQLPPKPALDLVPALTASQVGSCSS
CRSPGPGRAPPPAAACAECPPVISSTLSSPSSINPPSTSPSISAPSSRSSRSSAGSPLAA
ASGWCPSVVSSLGGGGPAALDSGRPLLSQAASQGNVTLLSKLLNQPDPTTTSTSTASTSV
NTSSATAVENKPDRLDRNHHHYNHNHTSALFAAAQNGHTERVKLLLSSGSPADVSHENGF
TPLHLAAAYGNSSCVEELLAAGAAVDAPTADGQTPLLLACEAGRLDCVRVLLTAGADRSR
TTEDGCTSLHAAVRSGHADTLRLLLGHPAQGDPAVTPDPPAGLLNQANGDGWTAAHMAAA
LGLKECLGVLCSHREQDISRRDKCNRTPHDLATDDCKDLLENLDVYQALVCLQRSGGGPG
RSLRLEEPSGTAANQLVLGRVLVDRSMRWAQLSTALNQVFASYLQTVCADASAVRGETTR
LPLGLGPGSISTILIGDTELLPGQELPLSPWDLVRKPLSQSISIRIKGLFDSCLDELALE
YLFPLPLLCNYVRLVEQYGNLIFHGLEGSCQEDMADAVACCIKSKQEAEGLGCDVVRVEV
DESLTKEQLLETFIDCGFLVPTAAASGGAARCVVVLLEGLEKASSLTGLLGDLCHSLDTR
DSSSPLLLNTGPHHFCDGSFLIATLSKPRLQGSELRLQQHFRWVTLRWDQEPLHGLLGRQ
LRRRLLHQMGSGIWSPDGVMERSVLWVSQVWQQLNACLSRLGTHEALLGPQLFLSCPVVS
NNTQAVVRWLARLWNAVVVPRVEEAIIARVTTKGSAAHTPSSPPQRPSLSNCGLSAGQQA
VVKAALSILVHKAVLPGCPLRRQEMDKYLLEFRGGLFPLSGISSYRGSAGVGGRRGRDSS
KLRRSNTSPRKKGGSTLKWSCGGSFREGSKSSTDVSFTANGKDQREPIGLSVFSDDETDL
IRELQTICSSKSEPDISKILQAKDELVLFSSARAKATPDRDAEREPASVQRLQTPGVRQS
CSSSGGQTAVPNRDRRSSPRARSQLPVPSSRGHQPRGSAASTSNGSPVRNQTPPTRGRIS
SRSKPMPPSSPASSSSQTQEDIWILNRDVHDSNKSTP
Download sequence
Identical sequences H3DF60
ENSTNIP00000019154 ENSTNIP00000002262 99883.ENSTNIP00000019154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]