SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DFC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DFC7
Domain Number 1 Region: 87-244
Classification Level Classification E-value
Superfamily E set domains 2.94e-53
Family RhoGDI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DFC7
Sequence length 248
Comment (tr|H3DFC7|H3DFC7_TETNG) Unc-119 homolog b (C. elegans) {ECO:0000313|Ensembl:ENSTNIP00000019221} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSYSCTNRGNSQDPSSAKDAAGDNPGRDTGGTDASPKQTAAMKVKKGCNSAEVGVPVTTE
EDLLSSAVITPEDVLGLQKITENYLCSPDENIFSIDFTRFKIRDMETGTVLFEITKPPTT
DKTGDKRDIDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDLPIENFRMIERHYFRERLL
KSFDFEFGFCMPRSKNTCEHIYEFPPLSEDSIQEMILHPYETQSDSFYFVDNKLVMHNKA
DYSYNGGR
Download sequence
Identical sequences H3DFC7
ENSTNIP00000019221 99883.ENSTNIP00000019221 ENSTNIP00000019221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]