SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DFF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DFF0
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-39
Family Third domain of FERM 0.00000203
Further Details:      
 
Domain Number 2 Region: 106-217
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-35
Family Second domain of FERM 0.00000207
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-24
Family First domain of FERM 0.000016
Further Details:      
 
Domain Number 4 Region: 511-601
Classification Level Classification E-value
Superfamily Moesin tail domain 4.84e-17
Family Moesin tail domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DFF0
Sequence length 601
Comment (tr|H3DFF0|H3DFF0_TETNG) Neurofibromin 2b (merlin) {ECO:0000313|Ensembl:ENSTNIP00000019244} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FPGPNIVKMSILGLKKKQPKTFKVKVITMDAEMEFSCEVKWKGKDLFDLVCRTVGLRETW
FFGLRYTIKDTYAWLKQEKRVLEQEVPKDSPITFHFLAKFFPEKVEEELVQEITQHLFFL
QVKKQILDEEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMT
ADMWEEKITAWYAEHRGIASLNRDEAEMEYLKIAQDLEMYGVSYFAITQNKRDTDLLLGV
DAQGLHIYSPNSKLSPNKSFPWSGIRNISYSEKEFTIKPLDKKKDVFKFYSSQLRVNKLI
LQLCIGNHDLFMRRRKVDSIEVQQMKAQAKEEKARKKMERQILAREKQMREEAERAKEEM
ERRLFQLQDEARLANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRLEVTA
MKTKEEKRLMEQKMREAEQLAVKLVEQSERRLKEADHLKQDLTEAKDAERRAKQKLLEIT
KTTYPLIAAYSTPPAPLAAPEAPDLPYDSGRLDFKDSDMKRLSMEIERERLEYMEKSKHL
QDQLKELKTEIESLKLEEQQQQAGLYSLRGDTRGYVQEPVYIPHSNRNSAYMSQMAFFEE
V
Download sequence
Identical sequences H3DFF0
ENSTNIP00000019244 99883.ENSTNIP00000019244 ENSTNIP00000019244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]